DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC100490933

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031760396.1 Gene:LOC100490933 / 100490933 -ID:- Length:414 Species:Xenopus tropicalis


Alignment Length:291 Identity:93/291 - (31%)
Similarity:143/291 - (49%) Gaps:22/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCG------NINTRHRIVGGQETEVHEYPWMIML-MWFGNFY---CGASLVNDQYALTAAHCVNG 127
            :||      |.:...|::.|...|...:|||..: |.:.:.|   ||..|:::::.:|||||::.
 Frog    28 TCGIRPLVKNHHRVRRVIEGNTPEPGSWPWMASIQMLYKDGYGSACGGVLLSNRWVVTAAHCLSD 92

  Fly   128 F--YHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
            .  |..|..:.|...:......:...|.:.:.:.|..:..:...:||||||.|.||:....:.|.
 Frog    93 LKRYRHLARIVLGARDLTQLGPETQIRTIKQWIQHEDFDHKTHKNDIALIRLNYPVKFSDYIQPA 157

  Fly   191 CMPTPSEN-YAGQTAVVTGWGALSE-GGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            |:|..|.| |......:.|||.|:| ...::..|||..|.::.::.|.:|::....|.|:.:|||
 Frog   158 CLPPKSSNVYKMDDCHIAGWGLLNEKPRTVTTMLQEATVELIDRKRCNSSDWYNGGIHDDNLCAG 222

  Fly   254 YVEQGGKDSCQGDSGGP-MHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            | ||||.|.|.|||||| |........|.:.||||||..|.:|::.||||.|..|..||...|  
 Frog   223 Y-EQGGPDVCMGDSGGPLMCKRKKAGIYYVVGIVSWGGLCGQPHSNGVYTSVQDFEQWIFNKT-- 284

  Fly   318 ACSCAQPEAAGEPASPMETTEQGDQENTTAN 348
                :.|:.....|:.|..:...:|.|...|
 Frog   285 ----SSPKYHYMKATSMNISPPSNQRNIEGN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/237 (34%)
Tryp_SPc 83..314 CDD:238113 82/239 (34%)
LOC100490933XP_031760396.1 Tryp_SPc 44..280 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.