DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and akt1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_004917247.1 Gene:akt1 / 100490038 XenbaseID:XB-GENE-484953 Length:493 Species:Xenopus tropicalis


Alignment Length:274 Identity:58/274 - (21%)
Similarity:91/274 - (33%) Gaps:98/274 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AKRECAECSCGN---INTRHRIVGGQETEVHEYPWMIMLMWFGN--------------------F 106
            ||.|.|.....|   .|:||..:...:.....:..:..:|.:.|                    |
 Frog   189 AKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERIFSEDRARF 253

  Fly   107 YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSD 171
            | ||.:|:   ||...|......:|.:.:..|..:: |.|:||.|..:.:               
 Frog   254 Y-GAEIVS---ALDYLHSEKNVVYRDLKLENLMLDK-DGHIKITDFGLCK--------------- 298

  Fly   172 IALIRFNEPVRLGIDMHPVCMPTP--------SENYAGQTAVVTGWGALSEGGPISDTLQEVEVP 228
                   |.::.|..|...| .||        .:|..|:  .|..||.    |.:...:....:|
 Frog   299 -------EGIKDGATMKTFC-GTPEYLAPEVLEDNDYGR--AVDWWGL----GVVMYEMMCGRLP 349

  Fly   229 ILSQ-----------EECR--NSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAY 280
            ..:|           ||.|  .:...|:|    .:.:|.::   ||..|...|||      .||.
 Frog   350 FYNQDHEKLFELILMEEIRFPRTLLPEAK----SLLSGLLK---KDPKQRLGGGP------DDAK 401

  Fly   281 QL------AGIVSW 288
            ::      |||| |
 Frog   402 EIMQHKFFAGIV-W 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 50/254 (20%)
Tryp_SPc 83..314 CDD:238113 50/253 (20%)
akt1XP_004917247.1 PH_PKB 4..111 CDD:269947
PKc_like 125..491 CDD:419665 58/274 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.