DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and hgfac

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002939269.3 Gene:hgfac / 100485696 XenbaseID:XB-GENE-940012 Length:595 Species:Xenopus tropicalis


Alignment Length:259 Identity:88/259 - (33%)
Similarity:133/259 - (51%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC-VNG 127
            ||..:|.:.....:..|.||:||.......:|| :..::.||::|..||:...:.::|||| .:.
 Frog   333 PAPPKCGKKHEKRVVARGRILGGNSALPGSHPW-VAGIYIGNYFCAGSLIQPCWVVSAAHCFADS 396

  Fly   128 FYHRLITVRLLEH--NRQDSHVKIVDRRVSRVLIHPKYST--RNFDSDIALIRF----NEPVRLG 184
            .....|.|.|.:|  |:.....:..:  |.|.:.:.|||.  || :.||.||:.    |...:..
 Frog   397 PSKSKIRVVLGQHFFNQTTDVTQTFE--VERYIFYDKYSVFKRN-EHDIVLIKLKRINNACAKKT 458

  Fly   185 IDMHPVCMPTPSENYA-GQTAVVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNYGESKITD 247
            ..:..:|:|..|..:| .....:.|||.:.|.. ..:..|||..||::...:|.:.....::|::
 Frog   459 QFVQTICLPDVSAPFADDHHCQIAGWGRMHEDSTEYAQNLQEAIVPLVPDNKCSSPEIYGAEISE 523

  Fly   248 NMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ||.||||.: ...||||||||||:.......:| |.|||||||||...|.|||||:|.::.|||
 Frog   524 NMFCAGYFD-CTIDSCQGDSGGPLACEKDKISY-LWGIVSWGEGCGNHNKPGVYTKVSNYVDWI 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/239 (34%)
Tryp_SPc 83..314 CDD:238113 83/240 (35%)
hgfacXP_002939269.3 FN2 52..98 CDD:238019
EGF_CA 109..145 CDD:238011
FN1 147..185 CDD:238018
KR 235..319 CDD:294073
Tryp_SPc 351..585 CDD:214473 82/239 (34%)
Tryp_SPc 352..588 CDD:238113 83/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.