DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ovch1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031754522.1 Gene:ovch1 / 100485041 XenbaseID:XB-GENE-6449526 Length:1514 Species:Xenopus tropicalis


Alignment Length:284 Identity:100/284 - (35%)
Similarity:161/284 - (56%) Gaps:12/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            ||:||:|...:.:||.:.:::...|:||.::::.|:.||||||:.........:...:|:|..:.
 Frog   589 RIIGGEEACPNCWPWQVRILFLKAFHCGGAIISPQWVLTAAHCIRASEPSYWVIVAGDHDRMLNE 653

  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT-AVVTGWG 210
            .....|.:..:.||..|::.|:|:||||:...||:.....:.|||:|.|.|.....: .||||||
 Frog   654 SMEQIRNIKAIRIHEDYNSENYDNDIALLYLEEPLEFNDFLRPVCLPEPEEALTPTSLCVVTGWG 718

  Fly   211 ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLG 275
            ..:|||..:..||::.:|||..:.| |.:|...::|::|:|||:.....||:||||||||:....
 Frog   719 NTAEGGQPALRLQQLHLPILDSKIC-NESYYPGQMTNHMLCAGFPSSKAKDACQGDSGGPLVCGN 782

  Fly   276 SGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQG 340
            :.:.|.:.|:|||||||.:...|||||:|..|..||.:..:|.     .:.:|.|.|.:  .|| 
 Frog   783 TKEQYFIYGLVSWGEGCGQVYKPGVYTKVRLFLTWIQKAQQDL-----QQESGPPNSKL--VEQ- 839

  Fly   341 DQENTTANGAAEADPEVEEANKLI 364
             :|...|.|.: ::..|:|...||
 Frog   840 -REGKAAKGCS-SEALVKELVGLI 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/229 (37%)
Tryp_SPc 83..314 CDD:238113 86/231 (37%)
ovch1XP_031754522.1 Tryp_SPc 74..309 CDD:238113
CUB 321..424 CDD:238001
CUB 435..546 CDD:238001
Tryp_SPc 590..820 CDD:238113 86/230 (37%)
CUB 859..962 CDD:238001 2/3 (67%)
CUB 979..1091 CDD:238001
CUB 1128..1226 CDD:238001
Tryp_SPc 1285..1508 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48875
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.