DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC100331291

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:331 Identity:115/331 - (34%)
Similarity:162/331 - (48%) Gaps:78/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAE------CSCG-N 76
            |:..|.:.||.  |.||.                :.||      ....::|.:      |.|| .
Zfish   644 CSPSSFKCASG--KCLNK----------------MNPE------CDGIKDCKDGSDELRCGCGTR 684

  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMW--FGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE 139
            ...|.:||||.:.:...:||.:.|..  :|: .||||||..::.::||||.              
Zfish   685 PRKRAKIVGGTDAQAGSWPWQVSLQMERYGH-VCGASLVASRWLVSAAHCF-------------- 734

  Fly   140 HNRQDSH-VKIVD----------------------RRVSRVLIHPKYSTRNFDSDIALIRFNEPV 181
               |||. :|..|                      |::.|:::|.:|.....|.||||:..:.||
Zfish   735 ---QDSDAIKYSDARSWRAYMGMRVMNSVSNAAATRQIRRIVLHSQYDQFTSDYDIALLELSAPV 796

  Fly   182 RLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKI 245
            .....:.|||:|.||..: :|.:..|||||.|:|.|.::..|||..|.|::...| |..|.:: :
Zfish   797 FFNELVQPVCVPAPSHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTC-NKMYDDA-V 859

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW 310
            |..|:|||.: |||.|:||||||||:..|..|..:.||||||||||||:.|.|||||||..|.||
Zfish   860 TPRMLCAGNI-QGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTRVIKFTDW 923

  Fly   311 IAENTR 316
            |.:.|:
Zfish   924 IHQQTK 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 98/254 (39%)
Tryp_SPc 83..314 CDD:238113 100/256 (39%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060 10/58 (17%)
Tryp_SPc 691..927 CDD:238113 100/256 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6379
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.