DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and corin

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_009295418.2 Gene:corin / 100320926 ZFINID:ZDB-GENE-060224-3 Length:1036 Species:Danio rerio


Alignment Length:324 Identity:95/324 - (29%)
Similarity:145/324 - (44%) Gaps:43/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LACATPSLRSASDPEKILNNLAQLRQSSFL----DW-------IQSILGPEVPAEWSSPAKR--- 67
            :.|....|.|....:.:|:....:|:..:|    ||       :|.:|  |...:.....|:   
Zfish   715 VTCTQMGLGSPLSTDAMLDVSPVVRRKRWLHVDPDWSPENMLPLQGLL--EKRGQSCQSYKKISL 777

  Fly    68 ECAECSCGN---INTRHRIVGGQETEVHEYPWMIMLMWF-GNFYCGASLVNDQYALTAAHCVNG- 127
            :|....||.   .....||:||:.:....:||...|... ....||..|:.:::|||.|||..| 
Zfish   778 QCTRDECGRRPAARLVKRILGGRTSRPGRWPWQCSLQSDPSGHICGCVLIGNKWALTVAHCFEGR 842

  Fly   128 ----FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMH 188
                .:..::.:..|:|    ....:..|||..:::|.:|:....|.||:::.....|.:...:.
Zfish   843 ESADVWKVVLGINNLDH----PSPYMQTRRVKSIIVHSRYNRAVVDYDISVLELESEVLVTSYVR 903

  Fly   189 PVCMP-----TPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDN 248
            |||:|     ...:.|..    :||||.:....|..  |||.||.|:|..:|: |.:....||..
Zfish   904 PVCLPRHGQLPKPDKYCH----ITGWGHVGNRMPFK--LQEGEVRIISVSQCQ-SYFDMKTITSR 961

  Fly   249 MICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGC-AKPNAPGVYTRVGSFNDWI 311
            |:|||| |.|..|||.||||||:........:.|.|:.|||..| :|...||||..|..|.:||
Zfish   962 MLCAGY-EAGTIDSCMGDSGGPLVCEEDDGHWSLYGLTSWGSVCFSKVLGPGVYANVTHFTEWI 1024

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 78/240 (33%)
Tryp_SPc 83..314 CDD:238113 79/241 (33%)
corinXP_009295418.2 CRD_corin_1 136..258 CDD:143554
LDLa 268..299 CDD:238060
LDLa 301..335 CDD:238060
Ldl_recept_a 342..372 CDD:278486
LDLa 382..409 CDD:238060
CRD_corin_2 448..569 CDD:143579
LDLa 574..608 CDD:238060
LDLa <620..646 CDD:238060
LDLa 649..683 CDD:238060
SR 689..>728 CDD:214555 3/12 (25%)
Tryp_SPc 796..1027 CDD:238113 79/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.