DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tmprss15

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:264 Identity:101/264 - (38%)
Similarity:144/264 - (54%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF 128
            |:|.:..|.:.|  ....|:||||:.:...:|||:.|.|.|...|||:|::.::.:||||||.|.
Zfish   731 PSKSKIIEETDG--KKEGRVVGGQDAQRGAWPWMVSLQWLGGHACGATLIDREWLITAAHCVYGR 793

  Fly   129 YHRL----------ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL 183
            ..:|          .....:..|:|   |..||    :|::|..|:.|..:||.||:....||..
Zfish   794 NVQLSNWAAVLGLHAQFETINPNKQ---VFSVD----QVIMHKHYNKRTKESDFALMHLKTPVSY 851

  Fly   184 GIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITD 247
            ...:.|:|:|.|..:: .|:...:.|||.|||.|..:|.||:..||:||..:|:.. ..|...|:
Zfish   852 TDYVQPICLPDPGAHFEEGRKCFIAGWGLLSESGLKADVLQQAVVPLLSNTQCQEW-LPEYNFTE 915

  Fly   248 NMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIA 312
            .|:||||.| ||.|:||||||||:.....|. :.|.|..|:|.||.:|..||.|.||..|.||:|
Zfish   916 RMMCAGYAE-GGVDTCQGDSGGPLMCEEEGH-WVLVGATSFGIGCGRPQRPGAYARVSQFVDWVA 978

  Fly   313 ENTR 316
            ||.|
Zfish   979 ENRR 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/239 (38%)
Tryp_SPc 83..314 CDD:238113 93/241 (39%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335
Tryp_SPc 747..977 CDD:214473 92/239 (38%)
Tryp_SPc 748..980 CDD:238113 93/241 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6379
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.