DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:165423

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:328 Identity:116/328 - (35%)
Similarity:161/328 - (49%) Gaps:44/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WIQSIL--------GPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFG 104
            |..|:|        |.:.....|.||        ||......:||||.......:||...|...|
Zfish     3 WKLSLLCVVTLLSTGCDCQPTQSPPA--------CGKAPLNTKIVGGTNASAGSWPWQASLHESG 59

  Fly   105 NFYCGASLVNDQYALTAAHCV----NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYST 165
            :.:||.||::||:.|:||||.    |...:   ||.|...::...:...|.:.||:|::||.|..
Zfish    60 SHFCGGSLISDQWILSAAHCFPSNPNPSDY---TVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQG 121

  Fly   166 RNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGG--PISDTLQEVEVP 228
            ...|:|:||:..:.||.....:.|||:......:...|..:||||.:..|.  |....||||.||
Zfish   122 STHDNDMALLHLSSPVTFSNYIQPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVP 186

  Fly   229 ILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCA 293
            |:....|.....|.|.||:||:|||.: ||||||||||||||| |:.|.:.:..||:||:|:|||
Zfish   187 IVGNNLCNCLYGGGSSITNNMMCAGLM-QGGKDSCQGDSGGPM-VIKSFNTWVQAGVVSFGKGCA 249

  Fly   294 KPNAPGVYTRVGSFNDWIAENTR------DACSCAQPEAAGEPASPMETTEQGDQENTTANGAAE 352
            .||.||||.||..:.:||::..|      |..:..|.::...|..|           |...|:|.
Zfish   250 DPNYPGVYARVSQYQNWISQYVRASFIPVDVNAPIQDDSETCPTKP-----------TLCGGSAS 303

  Fly   353 ADP 355
            ..|
Zfish   304 VYP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/234 (41%)
Tryp_SPc 83..314 CDD:238113 98/236 (42%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 96/234 (41%)
Tryp_SPc 38..269 CDD:238113 98/235 (42%)
Tryp_SPc 299..473 CDD:304450 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587888
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.