DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:163079

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:253 Identity:87/253 - (34%)
Similarity:128/253 - (50%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWM--IMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVR 136
            ||......:|:||.......:||.  |.|.....||||.||:|..:.||.|..........|.|.
Zfish    27 CGRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVY 91

  Fly   137 LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAG 201
            |....:..|:...:.|.|::::.||.|:  :.||::||::.:.||.....:.|||:......:..
Zfish    92 LGRQTQNGSNPYEISRTVTKIIKHPNYN--SLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVD 154

  Fly   202 QTAV-VTGWGALSEGGPIS-----DTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGK 260
            .||. |||||.|:....:.     |.|||||.||::..|| |:.|| ..||:.::||||:.:.||
Zfish   155 GTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFEC-NAAYG-GIITNKLLCAGYLNEDGK 217

  Fly   261 DSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            ..|.||.|||: |:..|..:..:|:|..|. |..|..|.:|.||..:.|||:..|..:
Zfish   218 APCAGDVGGPL-VIKQGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWISYYTNSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/236 (35%)
Tryp_SPc 83..314 CDD:238113 84/238 (35%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 82/236 (35%)
Tryp_SPc 36..267 CDD:238113 83/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587754
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.