DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:294 Identity:103/294 - (35%)
Similarity:146/294 - (49%) Gaps:43/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTAAHC------VN 126
            |....||......|||||.|.....:||.:.:....|.: ||.|::...:.|:||||      |:
Zfish    18 CLAQVCGRPPLGKRIVGGVEASPGSWPWQVDIQMGSNGHVCGGSIIAKNWVLSAAHCFPNPSEVS 82

  Fly   127 GFYHRLITVRLLEH--NRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189
            .:     |:.:..|  |..:...|:  ..|.||:|...|:......|:||::...||.....:.|
Zfish    83 AY-----TLYMGRHLLNGYNQFEKV--SYVQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQP 140

  Fly   190 VCMPTPSENY-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECR------NSNYGESKI 245
            ||:|.....: :|....|||||...||..::.  .|:||||||:.|..|:      :|:.....|
Zfish   141 VCLPFADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSDSSTVDI 205

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHV-LGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            ..:|||||| ::|||||||||||||:.. :|:|...| ||:||:|.|||:.|.||:|:||.||..
Zfish   206 LSDMICAGY-KEGGKDSCQGDSGGPLVCPVGNGTWIQ-AGVVSFGLGCAQKNRPGIYSRVSSFEK 268

  Fly   310 WIAENTRDACSCAQPEA-------AGEPASPMET 336
            .|....        |||       ..|..:|:.|
Zfish   269 LIRTTV--------PEAYFLGHACRSESQTPLVT 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 93/247 (38%)
Tryp_SPc 83..314 CDD:238113 93/249 (37%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 93/249 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.