DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAP2B and Rap1

DIOPT Version :9

Sequence 1:NP_002877.2 Gene:RAP2B / 5912 HGNCID:9862 Length:183 Species:Homo sapiens
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster


Alignment Length:189 Identity:113/189 - (59%)
Similarity:143/189 - (75%) Gaps:11/189 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65
            |||||:||||||||||||||||||...|:|||||||||.|||::|||....:||||||||||||.
  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

Human    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGE 130
            :|||||:||||||:||||:..|.:|.|::.:|:||:|||..:.|||:|||||.|||.||.|....
  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130

Human   131 GKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAA------QPNGDEGCCSACVIL 183
            ||.||.:::|.|||||||.|.:|:::|.::|||:|..:      :|..     |.||:|
  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKK-----SLCVLL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAP2BNP_002877.2 Rap2 3..165 CDD:133376 105/161 (65%)
Effector region. /evidence=ECO:0000305 32..40 7/7 (100%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 105/161 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.