DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARD18 and casp1

DIOPT Version :9

Sequence 1:NP_067546.1 Gene:CARD18 / 59082 HGNCID:28861 Length:90 Species:Homo sapiens
Sequence 2:XP_012813105.2 Gene:casp1 / 100491605 XenbaseID:XB-GENE-485195 Length:408 Species:Xenopus tropicalis


Alignment Length:89 Identity:32/89 - (35%)
Similarity:47/89 - (52%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKG 65
            ||.| |:|.|::||....|..||.|||.||:..|::..::..:.:.|....|:.|.:||.:..||
 Frog     1 MAAQ-LKKVRKLFIDGCNAAIINNLLDDLLDKSVLTDSEVEYINECNAITKDRCRRMIDNIKNKG 64

Human    66 PKSCCKFIKHLCEEDPQLASKMGL 89
            ..|....::.|.|....||..|||
 Frog    65 DYSSNILLQCLVENHKTLAKNMGL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARD18NP_067546.1 CARD_CASP1-like 6..87 CDD:260036 26/80 (33%)
casp1XP_012813105.2 DD 4..86 CDD:417479 27/82 (33%)
CASc 158..406 CDD:214521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002802
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.