DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAP1A and RSR1

DIOPT Version :9

Sequence 1:NP_001010935.1 Gene:RAP1A / 5906 HGNCID:9855 Length:184 Species:Homo sapiens
Sequence 2:NP_011668.3 Gene:RSR1 / 853056 SGDID:S000003384 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:103/182 - (56%)
Similarity:138/182 - (75%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFT 65
            ||:|||||||:||||||.||||||||::::.|||||||||||.:|:|.:...||||||||..|||
Yeast     1 MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFT 65

Human    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQ 130
            |||:||:|:|.||.||||:|.:.:..:|.:||||:||:||::.|||:|:|||.||.:|||:..|:
Yeast    66 AMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEE 130

Human   131 GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQI--NRKTPVEKKKPKKKS 180
            |..::.:|....|.|:||..:.||:|:|.||||||  |....|..|..:.:|
Yeast   131 GIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKDARNQS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAP1ANP_001010935.1 Rap1 3..167 CDD:133375 97/165 (59%)
Effector region. /evidence=ECO:0000305 32..40 7/7 (100%)
RSR1NP_011668.3 RSR1 3..166 CDD:133377 96/162 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 204 1.000 Domainoid score I605
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I910
Isobase 1 0.950 - 0 Normalized mean entropy S256
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm52881
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.