DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RALA and RAS1

DIOPT Version :9

Sequence 1:NP_005393.2 Gene:RALA / 5898 HGNCID:9839 Length:206 Species:Homo sapiens
Sequence 2:NP_014744.1 Gene:RAS1 / 854268 SGDID:S000005627 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:91/201 - (45%)
Similarity:136/201 - (67%) Gaps:8/201 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQID 65
            |..||    :::..:|:::||.|||||||||:||:...||::|:||..|||||:||:|.:...:|
Yeast     1 MQGNK----STIREYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILD 61

Human    66 ILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSD 130
            ||||||||:|:|:|:.|.|:|||||.|:|:|...||.....:.:||.|||:.:.:|.::||||.|
Yeast    62 ILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVVVGNKLD 126

Human   131 LEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSL 195
            ||::||||.|:....|:|.|..::|||||...|||:.|:.|:|.:|    :|..:.|...::...
Yeast   127 LENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVR----DDGGKYNSMNRQLDN 187

Human   196 AKRIRE 201
            ...||:
Yeast   188 TNEIRD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RALANP_005393.2 RalA_RalB 15..177 CDD:206710 83/161 (52%)
Effector region 43..51 4/7 (57%)
RAS1NP_014744.1 small_GTPase 9..172 CDD:197466 83/162 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.