DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RALA and Rala

DIOPT Version :9

Sequence 1:NP_005393.2 Gene:RALA / 5898 HGNCID:9839 Length:206 Species:Homo sapiens
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:194 Identity:155/194 - (79%)
Similarity:170/194 - (87%) Gaps:2/194 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    13 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 77
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    10 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 74

Human    78 IRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEA 142
            |||||||||||||||||||:.|||.||.:|||||||||.||::||||||||.||.|||:|.:.|.
  Fly    75 IRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSEC 139

Human   143 KNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL 206
            :.||:||.|.|||||||||.||||||||||||||:||.||||..:|:.|.:  .|:.|.:|.:|
  Fly   140 QLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDR--CKKRRLKCTLL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RALANP_005393.2 RalA_RalB 15..177 CDD:206710 140/161 (87%)
Effector region 43..51 7/7 (100%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 140/161 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 279 1.000 Domainoid score I1704
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3942
Inparanoid 1 1.050 304 1.000 Inparanoid score I2662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm41018
orthoMCL 1 0.900 - - OOG6_104721
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3397
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.