DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAD51D and Rad51D

DIOPT Version :9

Sequence 1:NP_001136043.1 Gene:RAD51D / 5892 HGNCID:9823 Length:348 Species:Homo sapiens
Sequence 2:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster


Alignment Length:323 Identity:84/323 - (26%)
Similarity:143/323 - (44%) Gaps:64/323 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     9 CPG--LTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKTWRAHSSGNLGGLQLPQVPAGRS 71
            |.|  |:|..:.|||.:.|.:::|...||.:::       ::.|..:.                 
  Fly    11 CTGRLLSEYQLNLLRKNNICSLIDFYDADEKKL-------HELWAINI----------------- 51

Human    72 WSGVRNALKKAGLGHGGTDGLSLNAFDERGTA-----VSTSRLDKLLDA---GLYTGEVTEIVGG 128
             ..||...|:..|       |...:.|| ||.     .....||||||:   ....|.|.|:.|.
  Fly    52 -QSVRELKKELSL-------LPKGSVDE-GTPDFNYDTGIEELDKLLDSVEQPFKPGRVWELCGQ 107

Human   129 PGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAF 193
            ||.||||:...:|.|......|.||::|:....:..|:..:|:|:..|||....|::.|:||.|.
  Fly   108 PGVGKTQLLYTLALNFVWKHSQAVLFIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAA 172

Human   194 DIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQRE-GLALMMQLARELKTL 257
            ....:.|:|:.....:..: |.:|...|:|::||:.|..:...|.:.|: ..:::.:||.:::.|
  Fly   173 TGADINDLLKSFDHQLTAE-THASMQTKLVLIDSLAACFAFYRGRRMRDVRKSVLTELACKIRKL 236

Human   258 ARDLGMAVVVTN--HITRDRDS----------------GRLKPALGRSWSFVPSTRILLDTIE 302
            |. .|:|.|:.|  ....::||                .:|:|.||..||.|.:.|:.::..|
  Fly   237 AL-RGVAFVIGNVSFFENNKDSCGDDGEQNGDDEEVTRQQLEPMLGSYWSSVATLRLSVELPE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAD51DNP_001136043.1 P-loop_NTPase 109..337 CDD:304359 63/216 (29%)
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 63/221 (29%)
radB 80..335 CDD:236482 63/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8727
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5108
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55923
OrthoDB 1 1.010 - - D1214879at2759
OrthoFinder 1 1.000 - - FOG0006192
OrthoInspector 1 1.000 - - oto91357
orthoMCL 1 0.900 - - OOG6_105130
Panther 1 1.100 - - LDO PTHR46457
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4853
SonicParanoid 1 1.000 - - X5910
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.