DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAD51C and RAD57

DIOPT Version :9

Sequence 1:XP_006722064.1 Gene:RAD51C / 5889 HGNCID:9820 Length:377 Species:Homo sapiens
Sequence 2:NP_010287.1 Gene:RAD57 / 851567 SGDID:S000002411 Length:460 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:73/264 - (27%)
Similarity:124/264 - (46%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    37 ELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFII 101
            :.|.:.|.||::.:..|..|.....|::..|          .:|.:.:......:..::......
Yeast    47 DFLTLTPKELARLIQRSINEVFRFQQLLVHE----------YNEKYLEICEKNSISPDNGPECFT 101

Human   102 TFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMV 166
            |...|:|::||||:.....|||.|....||:||.||||:.||:.|..||:.|:.|:|.|||....
Yeast   102 TADVAMDELLGGGIFTHGITEIFGESSTGKSQLLMQLALSVQLSEPAGGLGGKCVYITTEGDLPT 166

Human   167 DRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYL----LP 227
            .|:..:.::                 |.|.|...:..  |:|:...|.|   |:.|.::    ||
Yeast   167 QRLESMLSS-----------------RPAYEKLGITQ--SNIFTVSCND---LINQEHIINVQLP 209

Human   228 DFLSEHSK--VRLVIVDGIAFPFRHDLDDLSLR-----TRLLNGLAQQMISLANNHRLAVILTNQ 285
             .|.|.||  ::|||:|.|:...|.:|.:.|.|     ...|:.:|:::..||:::.|:|::.||
Yeast   210 -ILLERSKGSIKLVIIDSISHHLRVELQNKSFRESQENKNYLDRMAEKLQILAHDYSLSVVVANQ 273

Human   286 MTTK 289
            :..|
Yeast   274 VGDK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAD51CXP_006722064.1 HHH_5 12..57 CDD:291205 5/19 (26%)
recomb_radA 21..349 CDD:131290 73/264 (28%)
Rad51_DMC1_radA 100..348 CDD:238543 64/201 (32%)
RAD57NP_010287.1 XRCC3 107..445 CDD:410899 62/194 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.