DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAC1 and RhoBTB

DIOPT Version :9

Sequence 1:NP_061485.1 Gene:RAC1 / 5879 HGNCID:9801 Length:211 Species:Homo sapiens
Sequence 2:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster


Alignment Length:236 Identity:83/236 - (35%)
Similarity:116/236 - (49%) Gaps:59/236 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     2 QAIKCVVVGDGAVGKTCLLISYTTN------AFPGEYIPTVF--DNYS--ANVM------VDGKP 50
            :.:|||:|||.|||||.|:.:...|      .....::|||:  |.|.  .:|:      |||..
  Fly    12 ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVN 76

Human    51 VNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAK 115
            |:|.||||.|..|.||          ...||:           :||.|:|||:.||.|..|.:..
  Fly    77 VSLRLWDTFGDHDKDR----------RFAYGR-----------SDVVLLCFSIASPISLRNCKMM 120

Human   116 WYPEVRHHCPNTPIILVGTKLDLR------------DDKDTIEK--LKEKKLTPITYPQGLAMAK 166
            ||||:|..||:.|:||||.|.|||            .:|.|..:  ||...:.|   .:..|:||
  Fly   121 WYPEIRRFCPDVPVILVGCKNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMP---DEARAVAK 182

Human   167 EIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRK 207
            |:| |.|.|.|..|..|:..||:.|||:.|    :.:|:::
  Fly   183 ELG-VAYYETSVFTYFGVNEVFENAIRSAL----IARRQQR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAC1NP_061485.1 Rac1_like 3..195 CDD:206663 81/221 (37%)
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 81/222 (36%)
RHO 16..211 CDD:197554 80/219 (37%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.