DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB5C and Rab32

DIOPT Version :10

Sequence 1:NP_001238968.1 Gene:RAB5C / 5878 HGNCID:9785 Length:249 Species:Homo sapiens
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:201 Identity:58/201 - (28%)
Similarity:103/201 - (51%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    55 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLD-DTTVKFEIWDTAGQERYHS 118
            :|::::||...||:|.:.|:|...|.:...:|||..|..:.:..| :|.|:.::||.|||||:.:
  Fly   484 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN 548

Human   119 LAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQ-----ASPNIVIALAGNKADLASKRAV- 177
            :..:||:.|..|.:|:|:|.:.||.....|.::|..:     .||...|.|| ||.|...:..: 
  Fly   549 MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLA-NKCDQEKQGIIT 612

Human   178 EFQEAQAYADDNSLL-FMETSAKTAMNVNEIFMAIAKKLPKNE----------------PQNATG 225
            :.::...|..:|... :.|||||..:|::|...|:..|:..|:                ..:|||
  Fly   613 QPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGDKFNLSAADATG 677

Human   226 APGRNR 231
            :..:|:
  Fly   678 SDAKNK 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB5CNP_001238968.1 Rab5_related 54..216 CDD:206653 53/168 (32%)
Rab32NP_525109.1 PHA03247 <126..481 CDD:223021
Rab32_Rab38 484..686 CDD:206692 58/201 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.