DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB6A and rab6a

DIOPT Version :9

Sequence 1:NP_002860.2 Gene:RAB6A / 5870 HGNCID:9786 Length:208 Species:Homo sapiens
Sequence 2:NP_989315.1 Gene:rab6a / 394940 XenbaseID:XB-GENE-494903 Length:208 Species:Xenopus tropicalis


Alignment Length:208 Identity:200/208 - (96%)
Similarity:204/208 - (98%) Gaps:0/208 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQ 65
            ||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
 Frog     1 MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 65

Human    66 LWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDL 130
            |||||||||||||||||||||..||||:|||||||||||||||||||||||||||||||||||||
 Frog    66 LWDTAGQERFRSLIPSYIRDSTVAVVVFDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDL 130

Human   131 ADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEK 195
            |||||||||||||||||||||||||||||||||||||||||||||||||:||:||||||||||||
 Frog   131 ADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESSQDKSREDMIDIKLEK 195

Human   196 PQEQPVSEGGCSC 208
            |.|||||||||||
 Frog   196 PPEQPVSEGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB6ANP_002860.2 Rab6 14..174 CDD:206654 155/159 (97%)
Effector region. /evidence=ECO:0000250 42..50 7/7 (100%)
rab6aNP_989315.1 Rab6 14..174 CDD:206654 155/159 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 310 1.000 Domainoid score I8880
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 404 1.000 Inparanoid score I9037
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - oto151616
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.