DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB5B and Rab5

DIOPT Version :9

Sequence 1:NP_001238965.1 Gene:RAB5B / 5869 HGNCID:9784 Length:215 Species:Homo sapiens
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:206 Identity:153/206 - (74%)
Similarity:177/206 - (85%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     8 RPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFE 72
            ||||..| :|.||||||||||||||||||||||||||||||||||||||||||::|::||.||||
  Fly    18 RPNGTSQ-NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFE 81

Human    73 IWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADL 137
            ||||||||||||||||||||||||||||||.||::|.|||||||||.:||||:||||||||||||
  Fly    82 IWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Human   138 ANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLH 202
            :|.|:||::||:.||::|.||||||||||.|||||:||||||||||::..|..|.:.|..|.:.:
  Fly   147 SNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETN 211

Human   203 EQSQQNKSQCC 213
            ..:    :.||
  Fly   212 RPT----NNCC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB5BNP_001238965.1 Rab5_related 20..182 CDD:206653 137/161 (85%)
Effector region. /evidence=ECO:0000255 49..57 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..215 6/28 (21%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 137/161 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1733
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 311 1.000 Inparanoid score I2594
Isobase 1 0.950 - 0 Normalized mean entropy S266
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 1 1.000 - - FOG0000845
OrthoInspector 1 1.000 - - otm41694
orthoMCL 1 0.900 - - OOG6_100743
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2000
SonicParanoid 1 1.000 - - X457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.