Sequence 1: | NP_004569.2 | Gene: | RAB4A / 5867 | HGNCID: | 9781 | Length: | 218 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477170.1 | Gene: | Rab11 / 42501 | FlyBaseID: | FBgn0015790 | Length: | 214 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 96/201 - (47%) |
---|---|---|---|
Similarity: | 122/201 - (60%) | Gaps: | 19/201 - (9%) |
- Green bases have known domain annotations that are detailed below.
Human 5 AMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDT 69
Human 70 AGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADR 134
Human 135 EVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAAL 199
Human 200 RQLRSP 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RAB4A | NP_004569.2 | Rab4 | 14..174 | CDD:206696 | 85/159 (53%) |
Effector region. /evidence=ECO:0000250 | 42..50 | 5/7 (71%) | |||
Rab11 | NP_477170.1 | Rab11_like | 9..173 | CDD:206660 | 90/182 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |