DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB4A and Rab14

DIOPT Version :9

Sequence 1:NP_004569.2 Gene:RAB4A / 5867 HGNCID:9781 Length:218 Species:Homo sapiens
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:218 Identity:125/218 - (57%)
Similarity:160/218 - (73%) Gaps:3/218 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     2 SQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQI 66
            :.||....|:::||:::||:.|.|||||||||.||||..:..||||||||::||.|..|.:||||
  Fly    24 NMTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQI 88

Human    67 WDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLD 131
            ||||||||||:|||||||||||||:|||||.|.|||.|::||||.|.|.:.:.||.|.|||.||:
  Fly    89 WDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLE 153

Human   132 ADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGD 196
            :.||||:.||..||.||.|||||.||:||:||||||::.||||...|:.|.||.....||:|:..
  Fly   154 STREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRP 218

Human   197 AALRQLRSPRRAQAPNAQ-ECGC 218
            :  :..|:...::|..|: :|.|
  Fly   219 S--QPSRTSLSSEATGAKDQCSC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB4ANP_004569.2 Rab4 14..174 CDD:206696 108/159 (68%)
Effector region. /evidence=ECO:0000250 42..50 5/7 (71%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 110/164 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.