DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KMT2C and SET4

DIOPT Version :9

Sequence 1:XP_005250082.1 Gene:KMT2C / 58508 HGNCID:13726 Length:4983 Species:Homo sapiens
Sequence 2:NP_012430.1 Gene:SET4 / 853339 SGDID:S000003641 Length:560 Species:Saccharomyces cerevisiae


Alignment Length:348 Identity:74/348 - (21%)
Similarity:122/348 - (35%) Gaps:94/348 - (27%)


- Green bases have known domain annotations that are detailed below.


Human  4707 DKILEPVACVRKKSEML--------QLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRY 4763
            |.|.....|.|..|:..        .:||..:..|.||..:         |:....|......:.
Yeast   196 DPIKRDFVCKRCDSDTKVQVNQVKPMIFPRKMGDERLFQFS---------SIVTTSASNTNQHQQ 251

Human  4764 GRNPLMELPLA-----VNPTGCARSEPKMSAHVKRFVLRPHTLN------STSTSKSFQSTVTGE 4817
            ..|.:.|.|..     ..||....:..:.....::.|:..|.|.      |:|....|::....|
Yeast   252 SVNNIEEQPKKRQLHYTAPTTENSNSIRKKLRQEKLVVSSHFLKPLLNEVSSSNDTEFKAITISE 316

Human  4818 LNAPYSKQFVHSKSSQYRKMKTEWKS----NVYLAR-SRIQGLGLYAARDIEKHTMVIEYIGTII 4877
            ....|.|.|:.:.......:.:.|:|    ::.:.: |..:..|::||....|..::.||:|.| 
Yeast   317 YKDKYVKMFIDNHYDDDWVVCSNWESSRSADIEVRKSSNERDFGVFAADSCVKGELIQEYLGKI- 380

Human  4878 RNEVANRKEKLYESQNRGVY----------MFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVV 4932
                  ..:|.|::.....|          :|.......||:..|||..|||..||.||  .|:|
Yeast   381 ------DFQKNYQTDPNNDYRLMGTTKPKVLFHPHWPLYIDSRETGGLTRYIRRSCEPN--VELV 437

Human  4933 TFE------RGH-----KIIISSSRRIQKGEELCYDYKFDFED----------DQHKIP------ 4970
            |..      ||.     |.::.:.|.|:||||:..::::|..:          |...:|      
Yeast   438 TVRPLDEKPRGDNDCRVKFVLRAIRDIRKGEEISVEWQWDLRNPIWEIINASKDLDSLPDPDKFW 502

Human  4971 -------------CHCGAV--NC 4978
                         |.||.:  ||
Yeast   503 LMGSIKTILTNCDCACGYLGHNC 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KMT2CXP_005250082.1 ePHD1_KMT2C 248..331 CDD:277166
PHD1_KMT2C_like 344..389 CDD:276984
PHD2_KMT2C 391..436 CDD:277069
PHD3_KMT2C 467..518 CDD:276986
PHD4_KMT2C 953..1009 CDD:277071
PHD5_KMT2C_like 1010..1056 CDD:276988
RanBP2-type Zn finger 1085..1107 CDD:275375
PHD6_KMT2C 1087..1137 CDD:277073
HMG-box 1671..1722 CDD:294061
DUF2962 1709..>1792 CDD:288077
SYCE1 <3198..3287 CDD:291886
ePHD2_KMT2C 4474..4578 CDD:277167
FYRN 4624..4674 CDD:283589
FYRC 4680..4761 CDD:283590 12/61 (20%)
SET <4797..4983 CDD:225491 56/245 (23%)
SET 4844..4965 CDD:214614 38/152 (25%)
PostSET 4967..4983 CDD:214703 6/33 (18%)
SET4NP_012430.1 SET 16..526 CDD:225491 74/348 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.