DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARHGAP22 and cyk-4

DIOPT Version :9

Sequence 1:XP_011538304.1 Gene:ARHGAP22 / 58504 HGNCID:30320 Length:720 Species:Homo sapiens
Sequence 2:NP_499845.1 Gene:cyk-4 / 176815 WormBaseID:WBGene00000875 Length:681 Species:Caenorhabditis elegans


Alignment Length:147 Identity:48/147 - (32%)
Similarity:76/147 - (51%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   193 LAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYL 257
            :.|..|..||..:..||||:||::|:|||...|..|.|.......|.. ...||..:...||.:|
 Worm   435 MIPAAVIHCVVALEARGLTQEGIYRVPGQVRTVNVLLDELRSKTVPNV-GLHDVEVITDTLKRFL 498

Human   258 RELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNV 322
            |:|.:|::|....::.:..|.|.:.|...|.|.|.:.:..|||||.:.|.|:.....:|.|.|:.
 Worm   499 RDLKDPLIPRTSRQELIVAANLYSTDPDNGRLALNRVICELPQANRDTLAYLFIHWRKVIAQSSR 563

Human   323 NKMSVQNLATVFGPNIL 339
            |||:.:.:|.:..|.::
 Worm   564 NKMNCEAMARMVAPAVM 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARHGAP22XP_011538304.1 PH_RhoGAP2 42..157 CDD:241529
RhoGAP_ARHGAP22_24_25 173..371 CDD:239855 48/147 (33%)
SMC_N <612..>700 CDD:330553
cyk-4NP_499845.1 DUF5098 33..>184 CDD:293628
C1 352..402 CDD:294036
RhoGAP_MgcRacGAP 418..615 CDD:239847 48/147 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.