DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc4

DIOPT Version :10

Sequence 1:NP_149017.2 Gene:BBS4 / 585 HGNCID:969 Length:519 Species:Homo sapiens
Sequence 2:NP_650451.1 Gene:Tmtc4 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster


Alignment Length:335 Identity:72/335 - (21%)
Similarity:139/335 - (41%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   140 NLGVC----YIYLKQFNKAQDQLH--NALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFS 198
            ::|.|    |.:|..::.:.:..|  .||.:....|..:|:.:......|.....:::|.|::..
  Fly   376 SIGFCLLSIYGFLYWYDSSTENTHWRTALRILLMLLFSVMMVRTRQRATDWLNEEQLFKSALQVC 440

Human   199 PENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVA 263
            |:|.::...:..|...:|...|||:|...|:...|....|::..|::.:.||....|....|:..
  Fly   441 PDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLAL 505

Human   264 CAVPESPPLWNNIGMCFFGKKKYVAAIS----CLK-RANYLAPFDWKILYNLGLVHLTMQQYASA 323
            .|.|..|..|.|:|:....:.||..|::    .|| |||:...:     ||:|.::|..::||.|
  Fly   506 QAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCY-----YNMGNLYLEQKRYAEA 565

Human   324 FHFLSAAINFQPKMGELYMLLAVALTN--LED----IEN-------------------------- 356
            .|....|:...|:..:.:..:...|.|  |:|    |.|                          
  Fly   566 LHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHY 630

Human   357 --AKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVE 419
              |:..|...:.|:..|.|.:.|..||.:...:.:.|:..|: ....:|..:..::.|..|::::
  Fly   631 TEAEAIYKRVIELEPHNTLYHTNLGVLYHRWDKTQEAIEAYR-TAISISAARATTARENLSKLLK 694

Human   420 MAQKLGAALQ 429
            ..::....:|
  Fly   695 RLEREAQVMQ 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_149017.2 Required for localization to centrosomes 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
TPR repeat 36..61 CDD:276809
TPR 1 67..100
TPR repeat 68..95 CDD:276809
LapB 71..332 CDD:442196 51/202 (25%)
Interaction with PCM1. /evidence=ECO:0000269|PubMed:15107855 101..337 52/207 (25%)
TPR repeat 101..129 CDD:276809
TPR repeat 134..164 CDD:276809 7/29 (24%)
TPR repeat 169..196 CDD:276809 5/26 (19%)
TPR repeat 202..229 CDD:276809 6/26 (23%)
TPR repeat 236..264 CDD:276809 6/27 (22%)
Spy 250..>446 CDD:443119 47/219 (21%)
TPR repeat 270..298 CDD:276809 11/32 (34%)
TPR repeat 303..333 CDD:276809 9/29 (31%)
Required for localization to centrosomes 338..519 20/126 (16%)
TPR repeat 338..365 CDD:276809 8/60 (13%)
TPR repeat 372..397 CDD:276809 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..519
Tmtc4NP_650451.1 TMTC_DUF1736 258..331 CDD:462468
LapB 431..675 CDD:442196 58/249 (23%)
TPR repeat 444..472 CDD:276809 7/27 (26%)
TPR repeat 480..506 CDD:276809 6/25 (24%)
TPR repeat 511..541 CDD:276809 8/29 (28%)
TPR repeat 546..574 CDD:276809 9/32 (28%)
TPR repeat 580..608 CDD:276809 6/27 (22%)
TPR repeat 614..642 CDD:276809 2/27 (7%)
TPR repeat 647..677 CDD:276809 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.