DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc3

DIOPT Version :9

Sequence 1:NP_149017.2 Gene:BBS4 / 585 HGNCID:969 Length:519 Species:Homo sapiens
Sequence 2:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster


Alignment Length:377 Identity:83/377 - (22%)
Similarity:159/377 - (42%) Gaps:48/377 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    80 EGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEA-AKLNQKDWEISHNLGV 143
            ||..:|:|..||....:..........|.|:...|.::..|.:.|.:| |...|....:|::..:
  Fly   527 EGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARI 591

Human   144 CYIYLKQF-------NKAQDQLHNALNLNRHDLT--------YIMLGKIHLLEGDLDKAIEVYKK 193
            ...:|..|       .|.|.:|..|.:|.|..::        ||..|.|.:......:|.|||::
  Fly   592 APNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQ 656

Human   194 AVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFD---VA 255
            |:.:..||.::...||:::|:.|..|:|..:...|:...|.:.:|:|.:..::|..|..:   |:
  Fly   657 ALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRVS 721

Human   256 LTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQY 320
            .::...|.....::..::.|:||....:..:..|....|||.:|.......|:||.|:....::.
  Fly   722 RSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRP 786

Human   321 ASAFHFLSAAINFQPK-------MGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNY 378
            ..|..||:..|...|.       :|::|      :.:::|::.|::.|...:|.|..|.....|.
  Fly   787 LDAVPFLNQLIRHHPSHVKGLILLGDIY------INHMKDLDEAEKCYRSILHYDPHNTQGLHNL 845

Human   379 AVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQV 430
            .|:.               :|:| .|.|..:.|::...:......:|..||:
  Fly   846 CVVF---------------VERK-RLAKAAACLQYAQRLAPAEDYIGRHLQI 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_149017.2 Required for localization to centrosomes 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
TPR_11 <18..400 CDD:330823 75/345 (22%)
TPR repeat 36..61 CDD:276809
TPR 1 67..100 6/19 (32%)
TPR repeat 68..95 CDD:276809 6/14 (43%)
Interaction with PCM1. /evidence=ECO:0000269|PubMed:15107855 101..337 59/261 (23%)
TPR repeat 101..129 CDD:276809 6/28 (21%)
TPR repeat 134..164 CDD:276809 7/36 (19%)
TPR repeat 169..196 CDD:276809 9/34 (26%)
TPR repeat 202..229 CDD:276809 6/26 (23%)
TPR repeat 236..264 CDD:276809 6/30 (20%)
TPR repeat 270..298 CDD:276809 7/27 (26%)
TPR repeat 303..333 CDD:276809 8/29 (28%)
Required for localization to centrosomes 338..519 18/93 (19%)
TPR repeat 338..365 CDD:276809 5/26 (19%)
TPR repeat 372..397 CDD:276809 2/24 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..519
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 80/365 (22%)
TPR repeat 514..542 CDD:276809 6/14 (43%)
TPR repeat 547..591 CDD:276809 9/43 (21%)
TPR repeat 598..625 CDD:276809 7/26 (27%)
TPR repeat 630..660 CDD:276809 9/29 (31%)
TPR repeat 665..693 CDD:276809 7/27 (26%)
TPR repeat 737..764 CDD:276809 7/26 (27%)
TPR repeat 803..834 CDD:276809 5/36 (14%)
TPR repeat 839..867 CDD:276809 7/43 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.