DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment BBS4 and CG14921

DIOPT Version :9

Sequence 1:	NP_149017.2	Gene:	BBS4 / 585	HGNCID:	969	Length:	519	Species:	Homo sapiens
Sequence 2:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster

Alignment Length:	161	Identity:	34/161 - (21%)
Similarity:	61/161 - (37%)	Gaps:	52/161 - (32%)

- Green bases have known domain annotations that are detailed below.

Human   376 LNYAVLLYNQGEKKN--ALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTK 438
            |..|.|:..:.:|::  ||.:| :.:::..:.|:   ::.:::|.|..::. ....|.||||
  Fly    94 LEIADLIVERNKKRDEKALERY-DNKRRAEIQKE---IQRETDMRERVKQF-QENSVREALV--- 150

Human   439 PVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEP 503
                ...:.:..:|.||.:.|.|                    || :||.|:...|...|  |..
  Fly   151 ----VDVRKEAKATPKPDTLQYP--------------------PS-SGGASRLATPLMRP--PMS 188

Human   504 AVESS---------------PTETSEQIREK 519
            :|..|               |...|:...||
  Fly   189 SVRGSGRINVNFTTQHKRVTPKRESQAAMEK 219

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
BBS4	NP_149017.2	Required for localization to centrosomes	1..66
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		TPR_11	<18..400	CDD:330823	7/25 (28%)
		TPR repeat	36..61	CDD:276809
		TPR 1	67..100
		TPR repeat	68..95	CDD:276809
		Interaction with PCM1. /evidence=ECO:0000269\|PubMed:15107855	101..337
		TPR repeat	101..129	CDD:276809
		TPR repeat	134..164	CDD:276809
		TPR repeat	169..196	CDD:276809
		TPR repeat	202..229	CDD:276809
		TPR repeat	236..264	CDD:276809
		TPR repeat	270..298	CDD:276809
		TPR repeat	303..333	CDD:276809
		Required for localization to centrosomes	338..519		32/159 (20%)
		TPR repeat	338..365	CDD:276809
		TPR repeat	372..397	CDD:276809	7/22 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	440..519		17/93 (18%)
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900