DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc2

DIOPT Version :10

Sequence 1:NP_149017.2 Gene:BBS4 / 585 HGNCID:969 Length:519 Species:Homo sapiens
Sequence 2:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster


Alignment Length:437 Identity:87/437 - (19%)
Similarity:156/437 - (35%) Gaps:107/437 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    30 PILEKQNWLIHLHYIRKD---------------YEACKAVIKEQLQETQGLCEYAIYVQALIFR- 78
            |.|...|.|.::.::..:               |...|.:...|......|..:::.:.|:..| 
  Fly   515 PFLPASNLLFYVGFVVAERLLYLPSVGFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRT 579

Human    79 LEGNI--QESLELFQTCAVLSPQSA-DNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHN 140
            |..|.  ::...|:::...::|..| .||..|..|   .|:::.|.:|..||.:......::..|
  Fly   580 LRRNADWRDEESLYRSAIAINPPKALGNLGSVLSS---QGRYEEAKQVLQEAIRFRPNMADVHFN 641

Human   141 LGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELL 205
            ||:                    |:::...|             ..|:|.:::|::|.|......
  Fly   642 LGI--------------------LHQNQQVY-------------PAAVECFQRAIKFRPNLAVAY 673

Human   206 TTLGLLYLQLGIYQKAFEHL-------GNAL----TYDPTNYKAILAAGSMMQTHGDFDVALTKY 259
            ..||:.::.||..|:|.|.|       |.|:    .:|.....|.|..|::....|....||..|
  Fly   674 LNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIY 738

Human   260 RVVACAVPESPP----LWNNIGMCF-------FGKKKYVAAISC--------------------- 292
            |....::|..|.    |:..||...       ..::.:.||:..                     
  Fly   739 REALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSR 803

Human   293 -------LKRANYLAPFDWKILYNLG-LVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALT 349
                   .|||..|||....:.::.. .:.|..:.:.||.:...|| ...|....|.:..|.|:.
  Fly   804 ASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAA-ELAPNDYTLVVAAATAMR 867

Human   350 NLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQ 396
            .|:...:|:..|.:||.|...:...:.|...:|:..|...:|.|.|:
  Fly   868 LLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRTNHAAASYK 914

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_149017.2 Required for localization to centrosomes 1..66 7/50 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
TPR repeat 36..61 CDD:276809 5/39 (13%)
TPR 1 67..100 6/35 (17%)
TPR repeat 68..95 CDD:276809 5/29 (17%)
LapB 71..332 CDD:442196 63/315 (20%)
Interaction with PCM1. /evidence=ECO:0000269|PubMed:15107855 101..337 58/287 (20%)
TPR repeat 101..129 CDD:276809 10/28 (36%)
TPR repeat 134..164 CDD:276809 3/29 (10%)
TPR repeat 169..196 CDD:276809 4/26 (15%)
TPR repeat 202..229 CDD:276809 9/33 (27%)
TPR repeat 236..264 CDD:276809 8/27 (30%)
Spy 250..>446 CDD:443119 39/187 (21%)
TPR repeat 270..298 CDD:276809 9/66 (14%)
TPR repeat 303..333 CDD:276809 5/30 (17%)
Required for localization to centrosomes 338..519 15/59 (25%)
TPR repeat 338..365 CDD:276809 6/26 (23%)
TPR repeat 372..397 CDD:276809 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..519
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 58/291 (20%)
TPR repeat 602..630 CDD:276809 10/30 (33%)
TPR repeat 635..665 CDD:276809 8/62 (13%)
TPR repeat 670..694 CDD:276809 7/23 (30%)
TPR repeat 715..743 CDD:276809 8/27 (30%)
TPR repeat 748..782 CDD:276809 6/33 (18%)
TPR 780..>933 CDD:440225 27/136 (20%)
TPR repeat 787..816 CDD:276809 3/28 (11%)
TPR repeat 822..850 CDD:276809 5/28 (18%)
TPR repeat 855..885 CDD:276809 8/29 (28%)
TPR repeat 890..918 CDD:276809 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.