DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and jam2

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_001072218.1 Gene:jam2 / 779665 XenbaseID:XB-GENE-493973 Length:295 Species:Xenopus tropicalis


Alignment Length:280 Identity:146/280 - (52%)
Similarity:192/280 - (68%) Gaps:12/280 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    19 VALGYHKA------YGFSAPKDQQVVTAVEYQEAILACKTP-KKTVSSRLEWKKL--GRSVSFVY 74
            :.|||..|      :|.....|...|...|:.|.||:||.. :|....||||||:  ...:||:|
 Frog     8 IFLGYFAALCCKETFGVYVSSDNSNVQVQEFGEIILSCKYKLEKEHPVRLEWKKVVPNGDISFIY 72

Human    75 YQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSC 139
            |..||..|.:.|||||:.:|.:||.||:|:|||||||:||.: .::.:|..:.|:|||||.||.|
 Frog    73 YNNTLAADLRGRAEMIESSIWLKNATRADSGKYRCEVTAPKD-NKSFQEIVIDLKVLVAPGVPVC 136

Human   140 EVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTV 204
            :||.||:|||.|||:|::.||.||.||.|:|:||.|..||...::.||||||:|:.:||||||||
 Frog   137 DVPPSAMSGTAVELKCRESEGFPASEYRWYKNGILLAINPAPNARLTNSSYTVNSASGTLQFNTV 201

Human   205 SKLDTGEYSCEARNSVG-YRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFS 268
            :|:|||||.|||.|.:| .::|..:|:||||||::||||.|||||||:..|||||.|||||||||
 Frog   202 AKMDTGEYYCEASNGIGKSQKCAVRRLQVDDLNVAGIIAGVVVVALVMLFCGLGVFYAQRKGYFS 266

Human   269 KETSFQKSNSSSKATTMSEN 288
            |..:..| .:|.|..:..||
 Frog   267 KGNASGK-EASQKTASQKEN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 43/97 (44%)
Ig 151..225 CDD:319273 43/74 (58%)
jam2NP_001072218.1 Ig 53..128 CDD:386229 35/75 (47%)
Ig_3 134..215 CDD:372822 50/80 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I28469
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10929
Inparanoid 1 1.050 292 1.000 Inparanoid score I10768
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG40756
OrthoDB 1 1.010 - - D1034087at2759
OrthoFinder 1 1.000 - - FOG0001462
OrthoInspector 1 1.000 - - oto154169
Panther 1 1.100 - - LDO PTHR44663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.