DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and tutl

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:110/262 - (41%) Gaps:54/262 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     3 RRSRHRL-------------------LLLLLRYLVV---ALGYHKAYGFSAPKDQQVVTAVEYQE 45
            ||||.|.                   .:.:|::::|   ||....|...:.|:|...:||:..:.
  Fly    81 RRSRRRAEGSSICVPIRRGQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEG 145

Human    46 AILACKTP---KKTVSSRLEW-KKLGRSVS----FVYYQ---QTLQGDFKNRAEMI-------DF 92
            .|..|...   ...|...|:| ||:..:.|    :::|:   :.::..:|.|...:       ..
  Fly   146 VIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSA 210

Human    93 NIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDT-VTLEVLVAP--AVPSCEVPSSALSGTVVELR 154
            ::.:.|:..||.|.|.|:|...:...:..:..| ..|:|...|  :|...::....|..::: |.
  Fly   211 SLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSII-LN 274

Human   155 CQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNS 219
            || .:|.|.||..|:||...:..:|.:|        ..|..| .|:.:|:...|.|||:|.|||.
  Fly   275 CQ-ADGTPTPEILWYKDANPVDPSPTVG--------IFNDGT-ELRISTIRHEDIGEYTCIARNG 329

Human   220 VG 221
            .|
  Fly   330 EG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 22/113 (19%)
Ig 151..225 CDD:319273 25/71 (35%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 22/112 (20%)
IG_like 137..229 CDD:214653 19/91 (21%)
I-set 253..341 CDD:254352 28/90 (31%)
IGc2 268..331 CDD:197706 24/73 (33%)
I-set 346..437 CDD:254352
Ig 349..437 CDD:299845
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.