DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and plum

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_001163744.1 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:84/218 - (38%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    32 PKDQQVVTAVEYQEAILACKTPKKTV------SSRLEWKKLGRSVSFVYYQQTLQGDFKNRA-EM 89
            ||::..:|.....||.|.......||      |..|:...:...|..|:|.|.........: ..
  Fly   260 PKNEAGITETAVSEAQLLPAFQNATVFVPAGGSVLLQCHAVADFVPIVWYLQPPNNKMVRLSNNS 324

Human    90 IDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPS---CEVPSSALSGTVV 151
            :.::|...::.|.: |:|.|...        ||.....:.|...|.:.|   .||....||.|  
  Fly   325 VAYSITNASIARHE-GRYSCITP--------LETQNFQVIVTTPPRIVSRLPVEVVYIGLSRT-- 378

Human   152 ELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEA 216
             |.|: .||:|.|..||:.:|:.|           |||||.......|..::....:.|.|.|.|
  Fly   379 -LTCR-AEGHPEPSITWYHNGVHL-----------NSSYTRYISGNELHVHSFDSKEEGIYQCVA 430

Human   217 RNSVGYRRCPGK---RMQVDDLN 236
            ||..|.....|:   ..|::::|
  Fly   431 RNVAGEDSATGELRFNRQLEEVN 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 19/101 (19%)
Ig 151..225 CDD:319273 23/73 (32%)
plumNP_001163744.1 IG_like 170..241 CDD:214653
IGc2 175..235 CDD:197706
IG_like 284..356 CDD:214653 15/80 (19%)
I-set 360..443 CDD:254352 31/97 (32%)
IGc2 378..435 CDD:197706 23/71 (32%)
FN3 804..886 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.