DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and otk

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster


Alignment Length:323 Identity:75/323 - (23%)
Similarity:127/323 - (39%) Gaps:92/323 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    30 SAPKDQQVVTAVEY----------QEAILA---CKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQG 81
            |:|...:|:..:::          .:|::|   ||. :.|.:.:::|.:.|.:.:...:.:    
  Fly   366 SSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHCKA-QGTPTPQVQWVRDGENTTLPDHVE---- 425

Human    82 DFKNRAEMIDFN--IRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAP--AVPSCEVP 142
                    :|.|  :..:||.....|.|.|  .|.:.|||  ...||.:.|:|.|  :||.....
  Fly   426 --------VDANGTLIFRNVNSEHRGNYTC--LATNSQGQ--INATVAINVVVTPKFSVPPVGPI 478

Human   143 SSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKL 207
            .::..|||| :.|| ..|:|.|...|.||...|.||      :|:.......:.|||:...|...
  Fly   479 ETSEQGTVV-MHCQ-AIGDPKPTIQWDKDLKYLSEN------NTDRERFRFLENGTLEIRNVQVE 535

Human   208 DTGEYSCEARNSVGYRRCPGKRMQVDDLNI-------------SG----------IIAAVVVVAL 249
            |.|.|.|...||.|.:|        :|:.:             ||          :|...|.:|.
  Fly   536 DEGSYGCTIGNSAGLKR--------EDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALAY 592

Human   250 VISVCGLGV-CYAQRKGYFSKETSFQKSNSSSKATTMSENVQWLTPVIPALWKAAAGGSRGQE 311
            ::.|.||.: |..:|:.        :|:..:..:|..:...|   |.:       ||..:|.|
  Fly   593 IVLVVGLMLWCRYRRQA--------RKARLNDLSTKEAGGDQ---PDV-------AGNGKGSE 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 21/109 (19%)
Ig 151..225 CDD:319273 24/73 (33%)
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 2/6 (33%)
Ig 395..460 CDD:143165 17/81 (21%)
I-set 468..559 CDD:254352 32/106 (30%)
IGc2 484..549 CDD:197706 26/72 (36%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.