DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:325 Identity:71/325 - (21%)
Similarity:128/325 - (39%) Gaps:54/325 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     6 RHRLLLLLLRYLVVALGYHKAYG--------FSAPKDQQVVTAVEYQEAILACKTPK-------- 54
            |.:||||||....:.|.......        |..|.:.  ||..:.::|...|....        
  Fly    69 RWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLEN--VTIAQGRDATFTCVVNNLGGHRVSG 131

Human    55 --KTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFN---IRIKNVTRSDAGKYRCEVSAP 114
              .:..:::.|.|.........::..:..:.:...:..|:|   :.|:.|...|||||.|:|:. 
  Fly   132 DGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT- 195

Human   115 SEQGQNLEEDTVTLEVLVAPAVPSCEVPSSAL--SGTVVELRCQDKEGNPAPEYTWFK-DGIRLL 176
                ..::..|.||||::.|.:.:.|.....:  .|...:|.|:.: |:|.|:.||.: ||..::
  Fly   196 ----DPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRAR-GHPKPKITWRREDGREII 255

Human   177 ENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCP---GKRMQVDD---- 234
              .|.||.....:.::..:..||  :.:::.:.|.|.|.|.|.|     |   .|||::..    
  Fly   256 --ARNGSHQKTKAQSVEGEMLTL--SKITRSEMGAYMCIASNGV-----PPTVSKRMKLQVHFHP 311

Human   235 -LNISGIIAAVVVVALVISVCGLGVCYAQRK--GYFSKETSFQKSNSSSKATTMSENVQWLTPVI 296
             :.:...:....|:..|..:|.:   .|..|  .|:.:|...........|.|..||..:...:|
  Fly   312 LVQVPNQLVGAPVLTDVTLICNV---EASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMI 373

Human   297  296
              Fly   374  373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 20/107 (19%)
Ig 151..225 CDD:319273 20/74 (27%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 24/117 (21%)
ig 102..195 CDD:278476 18/94 (19%)
IG_like 219..307 CDD:214653 25/97 (26%)
Ig 221..307 CDD:299845 25/95 (26%)
Ig 311..404 CDD:299845 12/66 (18%)
IG_like 327..405 CDD:214653 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.