DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and zig-10

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:298 Identity:61/298 - (20%)
Similarity:107/298 - (35%) Gaps:85/298 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     7 HRLLLLLLRYLVVALGYHKAYGFSAPKDQQV----VTAVEYQEAILACKTPKKTVSSRLEWKKLG 67
            |.|:|||:..:.::...|......||.::.|    .||:|       |   :...||.:.|.:..
 Worm     6 HYLVLLLILMIALSETIHTLAPKKAPTERLVPIGSTTALE-------C---EPYTSSNVTWYRDK 60

Human    68 RSVSFVYYQQTLQGDFKN-------------RAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQ 119
            ..::      |::| .||             |...|.|.: |.:|.:.|.|.|.|:....|:.|:
 Worm    61 HVIA------TVEG-HKNAILNERKPRGGEERIPEIGFLV-IFDVQKEDEGNYYCQRENDSKWGE 117

Human   120 -------NLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLE 177
                   .::|.:...::.:.|.||:.        |..:.|.|...:..|.|:.||..:.:.:  
 Worm   118 VFQLKIAYVDEISQNEKIKLEPNVPTL--------GRSLVLHCPIPKAYPPPKVTWTVNSLPI-- 172

Human   178 NPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGY---------RRCPGKRMQVD 233
                   |..||..:....|||..:..|....|.:.|...|..|:         |........:.
 Worm   173 -------SHISSDYVAFPNGTLIISHFSYHHFGYFECNINNFAGHASTNTFIDSRELVANLESLK 230

Human   234 DLNISGIIAAV-----------------VVVALVISVC 254
            ...::|..||:                 |::.|:.:||
 Worm   231 PTFVNGCSAALRSSLFMFLLGCLITSGAVLIYLICAVC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 24/118 (20%)
Ig 151..225 CDD:319273 18/82 (22%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 24/104 (23%)
IGc2 38..111 CDD:197706 20/90 (22%)
IG_like 143..215 CDD:214653 18/88 (20%)
IGc2 145..209 CDD:197706 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4563
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001462
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.