DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM2 and jam2a

DIOPT Version :9

Sequence 1:NP_001257337.1 Gene:JAM2 / 58494 HGNCID:14686 Length:312 Species:Homo sapiens
Sequence 2:NP_001091734.1 Gene:jam2a / 100005261 ZFINID:ZDB-GENE-031204-3 Length:307 Species:Danio rerio


Alignment Length:272 Identity:121/272 - (44%)
Similarity:172/272 - (63%) Gaps:25/272 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    32 PKDQQVVTAVEYQEAILAC--KTPKKTVSSRLEWKKLG--RSVSFVYYQQTLQGDFKNRAEMIDF 92
            ||    |...|:.:|.|:|  ||.|.| :.|:|||:..  :.||||||.:...|.|::||::...
Zfish    26 PK----VEVHEFSDAELSCEFKTEKDT-NPRIEWKRKDKEKDVSFVYYGERFVGPFQDRADIEGA 85

Human    93 NIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQD 157
            .:|::.||::|||:|||||||||: ..:|.|..|||.|||.|..|||:||||||:|:.|||||:|
Zfish    86 TVRLRRVTQADAGEYRCEVSAPSD-SISLGETNVTLRVLVPPQTPSCDVPSSALTGSQVELRCRD 149

Human   158 KEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVG- 221
            :...|...|||:||      |..|..:..|::||:|..||.|.|.|||:.|.|:|.|||:|.|| 
Zfish   150 RHSIPPAVYTWYKD------NRALPIRHPNATYTVNEFTGVLMFQTVSRSDAGQYHCEAKNGVGP 208

Human   222 YRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKE--TSF------QKSNS 278
            .:.|....||:||||::.:::|||:|.:::.:|..|||.|.|:||||:.  .||      ..::.
Zfish   209 PKSCQHTHMQIDDLNVAAVVSAVVLVCVILVLCAFGVCLAHRQGYFSRHRGRSFWIPHCHGVTHI 273

Human   279 SSKATTMSENVQ 290
            ||:....||:.|
Zfish   274 SSQNLNPSEHTQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM2NP_001257337.1 IG_like 35..130 CDD:214653 43/98 (44%)
Ig 151..225 CDD:319273 34/74 (46%)
jam2aNP_001091734.1 IG_like 26..119 CDD:214653 42/98 (43%)
Ig 28..123 CDD:299845 43/96 (45%)
Ig_2 129..211 CDD:290606 44/87 (51%)
IG_like 136..207 CDD:214653 36/76 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194326265
Domainoid 1 1.000 75 1.000 Domainoid score I30811
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1034087at2759
OrthoFinder 1 1.000 - - FOG0001462
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_116405
Panther 1 1.100 - - LDO PTHR44663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1111.350

Return to query results.
Submit another query.