DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEX2 and Pex2

DIOPT Version :9

Sequence 1:NP_000309.2 Gene:PEX2 / 5828 HGNCID:9717 Length:305 Species:Homo sapiens
Sequence 2:NP_648210.1 Gene:Pex2 / 38941 FlyBaseID:FBgn0035876 Length:281 Species:Drosophila melanogaster


Alignment Length:299 Identity:89/299 - (29%)
Similarity:148/299 - (49%) Gaps:40/299 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    14 VLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQ 78
            |.|::|:||:.|||.:.:|:.....:......|.|..:.:||:...:...:|..::..:.:|.||
  Fly     7 VPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKRCSTFGQ 71

Human    79 SVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTI----GGRWLEERCYDLFRNHHLASFGKVKQCV 139
            .:|.:.|.        .:..:.::.:.:.:.|:    ...|.|.|   |.|.....|     :.:
  Fly    72 QLLVLAYD--------AEKLTVSRLVLHFILTVLPGYVKSWEERR---LTRRVEWFS-----EAI 120

Human   140 NFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKPQNICEVGFEYMNRELLWHGFAEFL 204
            .:|.....:..::|:..||:.|:..||.:.|||:..:..:.....::|::|:.|||||.||.|.|
  Fly   121 MWVENSALILNILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIGYKYLTRELLWGGFMEIL 185

Human   205 IFLLPLINVQKLKAKLSSWCI----------PLTGAPNSDNTLATSGKECALCGEWPTMPHTIGC 259
            ..:||:||.:||:..|.||..          |...||..  ||:|:   |..|||.||:||.:||
  Fly   186 GLVLPIINFRKLQRVLKSWTFSGRRLEDRDGPAFLAPQM--TLSTT---CTFCGERPTLPHHMGC 245

Human   260 EHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIE 298
            .||:||:|..::.|.|..|.||.||    |..| :|||:
  Fly   246 GHIYCYYCLNANVLTDASFCCPNCG----SACP-ESGIQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEX2NP_000309.2 Pex2_Pex12 27..224 CDD:398431 48/200 (24%)
RING-HC_PEX2 243..284 CDD:319440 20/40 (50%)
Pex2NP_648210.1 Pex2_Pex12 22..207 CDD:282595 48/200 (24%)
RING 230..269 CDD:214546 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158685
Domainoid 1 1.000 69 1.000 Domainoid score I9678
eggNOG 1 0.900 - - E1_KOG2879
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H269
Inparanoid 1 1.050 134 1.000 Inparanoid score I4600
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53949
OrthoDB 1 1.010 - - D1494604at2759
OrthoFinder 1 1.000 - - FOG0005881
OrthoInspector 1 1.000 - - oto90667
orthoMCL 1 0.900 - - OOG6_103635
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5623
SonicParanoid 1 1.000 - - X5660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.