DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NECTIN1 and syg-1

DIOPT Version :9

Sequence 1:NP_002846.3 Gene:NECTIN1 / 5818 HGNCID:9706 Length:517 Species:Homo sapiens
Sequence 2:NP_001123159.1 Gene:syg-1 / 180555 WormBaseID:WBGene00006365 Length:730 Species:Caenorhabditis elegans


Alignment Length:390 Identity:78/390 - (20%)
Similarity:135/390 - (34%) Gaps:107/390 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    12 RW--WGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGS 74
            ||  |.|.|.........:..::|:........:|...:|.|...:....|:     |.|...| 
 Worm     3 RWQTWPLLLLFQLVTCQQLQQRIVEAPKDTLAAVGETAILTCRVEHQQGPVQ-----WMKDDFG- 61

Human    75 KQNVAIYNPSMGVSVLAP------YRERVEFLRPSFTDG--TIRLSRLELEDEGVYICEFATFPT 131
                      :|.....|      ||     :..|..:|  .:.:|.:.|.|:..:.|:.:....
 Worm    62 ----------LGTDRDKPLPGNKRYR-----MVGSAANGEYNLEISNVTLFDDDDFACQISESDH 111

Human   132 GNR--ESQLNLTVMAKPT-NWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSW-------- 185
            ...  .|:..|||:.:|| ..|..:...|:|..|..   :..:|.|..||||..:.|        
 Worm   112 AKAVVSSKAKLTVLVRPTPPKIVKSHHSLKAIAGDP---ITQSCLSRKGKPPPTIGWAIASDEHG 173

Human   186 --------ETR-------LKGEAEYQEI-----------------RNPNGTVTVISRYRLVPSRE 218
                    |:|       .|.|...:.:                 |..:...:::|....:|..|
 Worm   174 KHIVSWLGESRSKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPE 238

Human   219 AHQQSLACIVNYHM---DRFK-ESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANP-PAT 278
            ...:.|.|| :.||   ::.: :|:.|:::|.|::.:.........:.....|.|..:|.| ...
 Worm   239 DDHKYLICI-SQHMTFPNKIEVDSVKLSLRYAPQINLTVASKLPLRENGSALLACNVNAKPLDNV 302

Human   279 EYHWTTLNGSLPK----------GVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNI 333
            :..|...|..|.:          .:|..||.:|              |||||.|||..|.:::|:
 Worm   303 KISWYKGNQKLRETGDTLTFETLKMEDHNRDIF--------------CEATNEIGTTRGSIKLNV 353

Human   334  333
             Worm   354  353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NECTIN1NP_002846.3 Ig1_Nectin-1_like 45..143 CDD:143294 19/107 (18%)
Ig2_Nectin-1_like 146..243 CDD:143298 28/141 (20%)
Ig 265..330 CDD:319273 20/75 (27%)
Interaction with FGFR. /evidence=ECO:0000250 282..299 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..488
syg-1NP_001123159.1 I-set 24..124 CDD:254352 20/120 (17%)
Ig 30..124 CDD:299845 19/114 (17%)
Ig <151..265 CDD:299845 21/114 (18%)
Ig_2 276..353 CDD:290606 20/90 (22%)
IG_like 283..353 CDD:214653 20/83 (24%)
IG_like 363..427 CDD:214653
Ig_2 368..438 CDD:290606
Ig 440..528 CDD:299845
IG_like 450..535 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X243
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.