DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PVR and Fas3

DIOPT Version :9

Sequence 1:NP_006496.4 Gene:PVR / 5817 HGNCID:9705 Length:417 Species:Homo sapiens
Sequence 2:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster


Alignment Length:381 Identity:84/381 - (22%)
Similarity:137/381 - (35%) Gaps:116/381 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    64 LTWA---------------------RHGES---------GSMAVFHQTQGPSYSESKRLEFVAAR 98
            ||||                     |:|.|         |...|.:.:  |.:|::....:..|.
  Fly    17 LTWAQVNVEPNTALLNEGDRTELLCRYGRSINYCRIEIPGEQKVLNLS--PEWSKTPGFTYFGAG 79

Human    99 LGAELRNASLRMFGLRVEDEGNYTC-LFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVP 162
            |.|.....|:..  ::..:.|...| |.|...:.|.::|  |.|..:||...    ::|...|..
  Fly    80 LTAGQCGVSIER--VKASNNGQVKCSLGVEGEELSGTID--LVVALRPQQPI----IELLSRPNR 136

Human   163 ----------MARCVSTGGRPPAQITWHSDLGGMP-NTSQVP-GFLSGTVTVTSL--------WI 207
                      .|||....|||||.|:|:.|  .|| |....| ..:|.|.....|        |.
  Fly   137 EGYFNEGTEFRARCSVRDGRPPANISWYID--NMPANKRTTPLEVMSSTNDNVELSTSVQEIQWH 199

Human   208 LVPSSQVDGKNVTCKVEHESFEK---PQ----LLTVNLTVYYPPEVSISGYDNNWYLGQNEATLT 265
            |.|..  ..:.:.|:..|::..:   ||    ::.|.....:.|:.::.|.    || ::.|.:.
  Fly   200 LSPED--SNRKLVCRSHHQTDRESVPPQEAAYIINVRYAPVHQPDAAVYGL----YL-EHTAIVN 257

Human   266 CDARSNPEPTGYNWSTTMGPLPPFAVAQG-------------------------AQLLIRPVDKP 305
            ...|::|:|. ..| |..|.:    |.||                         |.|.:.     
  Fly   258 ITIRASPQPK-IEW-TIDGAI----VGQGRTDGRYSAYEPQYLGNDEYNVTLAIAGLTLE----- 311

Human   306 INTTLICNV--TNALGARQAELTVQVKEGPPSEHSGMSRNAIIFLVLGILVFLILL 359
             :||.|.|:  :|.||....::.:.....|||....::....|.:.:.:||.::||
  Fly   312 -DTTKIYNLRASNELGLTDYQVRISSSSKPPSSSLDVAAIVGIVVAVAVLVLVVLL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PVRNP_006496.4 Ig1_PVR_like 43..142 CDD:319295 22/108 (20%)
Ig2_Nectin-2_like 145..240 CDD:319328 30/121 (25%)
DYNLT1 binding 368..372
ITIM motif 396..401
Fas3NP_001097174.1 C2-set_2 141..221 CDD:285423 23/83 (28%)
Ig_TrkABC_d4 235..>333 CDD:143173 23/114 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28Q44
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.