DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PVR and kirre

DIOPT Version :10

Sequence 1:NP_006496.4 Gene:PVR / 5817 HGNCID:9705 Length:417 Species:Homo sapiens
Sequence 2:NP_525059.2 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:342 Identity:85/342 - (24%)
Similarity:131/342 - (38%) Gaps:75/342 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    27 GDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKR 91
            |......|......:|..|||||.:    ||  .|..|.|.:..       |...|..:.|..:|
  Fly    81 GQHFAMEPQDQTAVVGSRVTLPCRV----ME--KVGALQWTKDD-------FGLGQHRNLSGFER 132

Human    92 LEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGS---RSVDIWLRVLAKPQN------ 147
            ...|.:   .|..:.||.::.|.::|:..|.|.....|||.   ||....|.||..|:.      
  Fly   133 YSMVGS---DEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQG 194

Human   148 ----TAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTS----QVPGFLSGTVTVTS 204
                |.|.::::|        .|||.||:|.|:|||...||.:....    :.|...|..:|..|
  Fly   195 DYLVTTEDREIEL--------ECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARS 251

Human   205 LWILVPSSQVDGKNVTCKVEH---ESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQ----NEA 262
            :..|.|..:......||:.::   .::...:||   |.|.|.|:|.:|........|:    .|.
  Fly   252 ILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLL---LEVKYAPKVIVSVVGGALAGGKIPEGAEV 313

Human   263 TLTCDARSNPEPTGYNW----------STTMGPLPPFAVAQGAQLLIRPVDKPINTTLI-CNVTN 316
            .|:|.|.:||....|.|          .||             :::|..|.:..:..:: |.|.|
  Fly   314 ILSCQADANPHELSYRWFINDELMTGDFTT-------------KMIIHNVSRQYHDAIVKCEVVN 365

Human   317 ALGARQAELTVQVKEGP 333
            |:|..:....:.:..||
  Fly   366 AVGKSEQSKKLDISFGP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PVRNP_006496.4 IgV_1_Nectin-2_NecL-5_like_CD112_CD155 29..141 CDD:409581 30/114 (26%)
FR1 29..52 CDD:409581 7/22 (32%)
Ig strand A 29..33 CDD:409581 0/3 (0%)
Ig strand A' 35..39 CDD:409581 0/3 (0%)
Ig strand B 44..52 CDD:409581 5/7 (71%)
CDR1 53..61 CDD:409581 2/7 (29%)
FR2 62..68 CDD:409581 2/5 (40%)
Ig strand C 63..68 CDD:409581 2/4 (50%)
CDR2 69..86 CDD:409581 2/16 (13%)
Ig strand C' 76..81 CDD:409581 1/4 (25%)
Ig strand C' 83..86 CDD:409581 0/2 (0%)
FR3 87..127 CDD:409581 10/39 (26%)
Ig strand D 91..97 CDD:409581 2/5 (40%)
Ig strand E 105..112 CDD:409581 2/6 (33%)
Ig strand F 119..127 CDD:409581 2/7 (29%)
CDR3 128..131 CDD:409581 1/2 (50%)
Ig strand G 131..141 CDD:409581 4/12 (33%)
FR4 132..141 CDD:409581 3/11 (27%)
IgC1_2_Nectin-2_Necl-5_like 145..241 CDD:409500 27/112 (24%)
Ig strand A 145..151 CDD:409500 2/15 (13%)
Ig strand B 162..169 CDD:409500 2/6 (33%)
Ig strand C 174..180 CDD:409500 3/5 (60%)
Ig strand C' 182..184 CDD:409500 0/1 (0%)
Ig strand D 187..195 CDD:409500 1/11 (9%)
Ig strand E 200..208 CDD:409500 2/7 (29%)
Ig strand F 218..225 CDD:409500 2/6 (33%)
Ig strand G 231..237 CDD:409500 2/5 (40%)
Ig3_Nectin-5_like 244..329 CDD:409524 21/99 (21%)
Ig strand A 244..250 CDD:409524 2/5 (40%)
Ig strand B 262..266 CDD:409524 1/3 (33%)
Ig strand C 276..281 CDD:409524 2/14 (14%)
Ig strand C' 283..286 CDD:409524 0/2 (0%)
Ig strand D 289..294 CDD:409524 0/4 (0%)
Ig strand E 295..301 CDD:409524 1/5 (20%)
Ig strand F 306..316 CDD:409524 2/10 (20%)
Ig strand G 319..329 CDD:409524 1/9 (11%)
DYNLT1 binding 368..372
ITIM motif 396..401
kirreNP_525059.2 IG_like 88..182 CDD:214653 30/109 (28%)
Ig strand B 99..103 CDD:409552 3/3 (100%)
Ig strand E 144..148 CDD:409552 2/3 (67%)
Ig strand F 158..163 CDD:409552 2/4 (50%)
C2-set_2 189..279 CDD:400489 23/97 (24%)
Ig strand C 219..223 CDD:409416 2/3 (67%)
Ig strand E 251..255 CDD:409416 1/3 (33%)
Ig strand F 265..270 CDD:409416 2/4 (50%)
Ig strand G 280..283 CDD:409416 0/2 (0%)
Ig_2 307..379 CDD:464026 17/84 (20%)
Ig 382..462 CDD:472250 1/1 (100%)
Ig strand B 399..403 CDD:409353
Ig strand C 412..417 CDD:409353
Ig strand F 441..446 CDD:409353
Ig strand G 455..458 CDD:409353
Ig 466..561 CDD:472250
Ig strand B 482..486 CDD:409353
Ig strand C 496..500 CDD:409353
Ig strand E 529..533 CDD:409353
Ig strand F 543..548 CDD:409353
Ig strand G 556..559 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.