DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PVR and rst

DIOPT Version :10

Sequence 1:NP_006496.4 Gene:PVR / 5817 HGNCID:9705 Length:417 Species:Homo sapiens
Sequence 2:NP_525058.2 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:436 Identity:93/436 - (21%)
Similarity:158/436 - (36%) Gaps:118/436 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    34 PTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARH----GESGSMAVFHQTQGPSYSESKRLEF 94
            |......:|..|||||  :|.|.:.|    |.|.:.    |.|..::.|.:              
  Fly    34 PQDQTAVVGARVTLPC--RVINKQGT----LQWTKDDFGLGTSRDLSGFER-------------- 78

Human    95 VAARLGA-ELRNASLRMFGLRVEDEGNYTCLFVTFPQGS---RSVDIWLRVLAKPQ--------- 146
             .|.:|: |..:.||.::.:.::|:..|.|.....|:|.   ||....|.||..|:         
  Fly    79 -YAMVGSDEEGDYSLDIYPVMLDDDARYQCQVS
PGPEGQPAIRSTFAGLTVLVPPEAPKITQGDV 142

Human   147 -NTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTV---------T 201
             ...|.:||::        .|||.||:|.|:|||...||.:...:     :..||         |
  Fly   143 IYATEDRKVEI--------ECVSVGGKPAAEITWIDGLGNVLTDN-----IEYTVIPLPDQRRFT 194

Human   202 VTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSIS----------------- 249
            ..|:..|.|..:....|.:|:.::.:....:...:.:.|.|.|:|.::                 
  Fly   195 AKSVLRLTPKKEHHNTNFSCQAQNTADRTYR
SAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAG 259

Human   250 GYDNNWYLG-----QNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTT 309
            |...:...|     .::..|.|.|.:||....|.|.....|:   ...|..:::||.|.:..:..
  Fly   260 GGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPI---IGGQKTEMVIRNVTRKFHDA 321

Human   310 LI-CNVTNALGARQAELTVQVKEGPPSEHSGMSRNAIIFLVLGILVFLILLGIGIYFYWSKCSRE 373
            :: |.|.|::|..:...|:.:...|.......|..|.:..|:.:...:.          |....|
  Fly   322 IVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVD----------SNPQPE 376

Human   374 VLWHCHLCPS--------------STE-----HASASANGHVSYSA 400
            ::|..|  ||              |.|     :..|:..|:...||
  Fly   377 IVWIQH--PSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISA 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PVRNP_006496.4 IgV_1_Nectin-2_NecL-5_like_CD112_CD155 29..141 CDD:409581 28/114 (25%)
FR1 29..52 CDD:409581 7/17 (41%)
Ig strand A 29..33 CDD:409581
Ig strand A' 35..39 CDD:409581 0/3 (0%)
Ig strand B 44..52 CDD:409581 5/7 (71%)
CDR1 53..61 CDD:409581 3/7 (43%)
FR2 62..68 CDD:409581 2/5 (40%)
Ig strand C 63..68 CDD:409581 2/4 (50%)
CDR2 69..86 CDD:409581 3/20 (15%)
Ig strand C' 76..81 CDD:409581 1/4 (25%)
Ig strand C' 83..86 CDD:409581 0/2 (0%)
FR3 87..127 CDD:409581 8/40 (20%)
Ig strand D 91..97 CDD:409581 0/5 (0%)
Ig strand E 105..112 CDD:409581 2/6 (33%)
Ig strand F 119..127 CDD:409581 2/7 (29%)
CDR3 128..131 CDD:409581 1/2 (50%)
Ig strand G 131..141 CDD:409581 4/12 (33%)
FR4 132..141 CDD:409581 3/11 (27%)
IgC1_2_Nectin-2_Necl-5_like 145..241 CDD:409500 24/114 (21%)
Ig strand A 145..151 CDD:409500 1/15 (7%)
Ig strand B 162..169 CDD:409500 2/6 (33%)
Ig strand C 174..180 CDD:409500 3/5 (60%)
Ig strand C' 182..184 CDD:409500 0/1 (0%)
Ig strand D 187..195 CDD:409500 0/7 (0%)
Ig strand E 200..208 CDD:409500 3/16 (19%)
Ig strand F 218..225 CDD:409500 2/6 (33%)
Ig strand G 231..237 CDD:409500 0/5 (0%)
Ig3_Nectin-5_like 244..329 CDD:409524 21/107 (20%)
Ig strand A 244..250 CDD:409524 2/22 (9%)
Ig strand B 262..266 CDD:409524 1/3 (33%)
Ig strand C 276..281 CDD:409524 2/4 (50%)
Ig strand C' 283..286 CDD:409524 0/2 (0%)
Ig strand D 289..294 CDD:409524 0/4 (0%)
Ig strand E 295..301 CDD:409524 1/5 (20%)
Ig strand F 306..316 CDD:409524 2/10 (20%)
Ig strand G 319..329 CDD:409524 2/9 (22%)
DYNLT1 binding 368..372 1/3 (33%)
ITIM motif 396..401 2/5 (40%)
rstNP_525058.2 Ig 29..110 CDD:472250 23/96 (24%)
Ig strand B 45..49 CDD:409353 3/3 (100%)
Ig strand E 90..94 CDD:409353 2/3 (67%)
Ig strand F 104..109 CDD:409353 2/4 (50%)
C2-set_2 135..225 CDD:400489 23/102 (23%)
Ig strand B 151..155 CDD:409353 1/11 (9%)
Ig strand C 165..169 CDD:409353 2/3 (67%)
Ig strand E 197..201 CDD:409353 1/3 (33%)
Ig strand F 211..216 CDD:409353 2/4 (50%)
Ig strand G 226..229 CDD:409353 0/2 (0%)
Ig 271..340 CDD:472250 16/71 (23%)
Ig_3 346..411 CDD:464046 12/76 (16%)
Ig 428..524 CDD:472250
Ig strand B 446..450 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 491..495 CDD:409353
Ig strand F 505..510 CDD:409353
Ig strand G 518..521 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.