DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment runx1 and RunxA

DIOPT Version :9

Sequence 1:NP_571678.1 Gene:runx1 / 58126 ZFINID:ZDB-GENE-000605-1 Length:451 Species:Danio rerio
Sequence 2:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster


Alignment Length:463 Identity:176/463 - (38%)
Similarity:224/463 - (48%) Gaps:115/463 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish    51 MADRSMVEVLSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDIPDGTLVTVMAGND 115
            :|:|::.:.|::|||||:||.||.|:|:|||.|||.|||||:|||||:||||.|||:|||.||||
  Fly    83 LAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGND 147

Zfish   116 ENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPRE 180
            |||.|||||.||.:|||||:||||||||||||||||||||||.||||.:|||.:|||:|||||||
  Fly   148 ENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPRE 212

Zfish   181 PRRHRQKPDEAVKPGALAFSEQLRRSAMRCSPHHGPAPNTRPT--LNTPPFGSPAHSQIPDSRQM 243
            ||.....        :|...:|....|....|.|.   :|.|.  ...||.|         :.|.
  Fly   213 PRSKTML--------SLLGQQQQFHFAFGQRPFHF---STDPLSGFRMPPIG---------NCQS 257

Zfish   244 QTSPSWSY---EQSY-PYLGPISTPAVHPTTPISP--NRTAL--HCPELTAFTDPRVGLERSFPS 300
            .::..|.|   ..:| |||.  |:.....|||.|.  |..||  .|.......:...|...:...
  Fly   258 ASNTHWGYGSAASAYSPYLA--SSGLSSCTTPTSAQFNNPALGFTCSSNDQSNNQDFGGATNRDC 320

Zfish   301 LPSLPDGRFSD------PRVPYPTGAFTY-----------TPTPVTSAIGIGMSAMSSPAG---- 344
            :|.|||...||      ..|...:|..|:           ..:.|..|.| |.||.:..||    
  Fly   321 VPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNGASG-GGSAGAGTAGGGAG 384

Zfish   345 -----------------RYHTYLPPAYPAGSSQAQAGAFQASSSPYHLYYSSAAGS-YQFSMMPS 391
                             ||||.....|...|||         :.|..|..||.|.| .|..::.:
  Fly   385 SGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQ---------NGPRSLSDSSQAESPVQEDLLTT 440

Zfish   392 ----------GGAAAGERSPPRILPCTNASTG-------------SALLHPSL--PNQS-EGVVE 430
                      ||||.|...       :||.:|             ||:.:|::  .||: .|:|.
  Fly   441 NTPNLGSTAGGGAANGGAG-------SNAGSGAAGSGAGGAGGASSAVGNPAMLGANQNFPGIVN 498

Zfish   431 AEGSHSSS 438
             :..||::
  Fly   499 -QAQHSAA 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
runx1NP_571678.1 Runt 63..184 CDD:307137 97/120 (81%)
Atrophin-1 <160..426 CDD:331285 90/340 (26%)
RunxI 359..451 CDD:312115 26/107 (24%)
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/120 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2735
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm6398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.