DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mespba and CG33557

DIOPT Version :9

Sequence 1:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:143 Identity:35/143 - (24%)
Similarity:55/143 - (38%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish    10 SSSSSESEFSSISSPETTSPDQSFSPPHQTKPPCSKLVKSSNIMRKKRRLRLKNPSERRQNASEK 74
            |.::::||.|.|.. |.....|.....|:.:||                         ||..:.:
  Fly    31 SGAAADSEDSQIGQ-EANPGGQENQGNHRRRPP-------------------------RQKINAR 69

Zfish    75 EKLRMRDLTKALHHLRSFLPASVAPVGQTLTKIETLRLTIQYISFLSSQLGLSEEELSYRRQENS 139
            |:.|..::..|...||:.:|..  |:.:.|:|||.:||...||:.|||.|....|         .
  Fly    70 ERYRTFNVNSAYEALRNLIPTE--PMNRKLSKIEIIRLASSYITHLSSTLETGTE---------C 123

Zfish   140 SGCSLSSFECSSV 152
            ..|.|..:|...:
  Fly   124 QPCLLHKYESEGI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mespbaNP_571627.1 HLH 67..120 CDD:278439 17/52 (33%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.