DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mespaa and Fer1

DIOPT Version :9

Sequence 1:NP_571626.1 Gene:mespaa / 58069 ZFINID:ZDB-GENE-000406-8 Length:223 Species:Danio rerio
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:149 Identity:43/149 - (28%)
Similarity:71/149 - (47%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MDASTFSLQLQNCSFFLPDSQNQSFAVSDAGYYSATGSLSPTSSIDSCSFSPPAYSLLPQIFPKS 65
            ||  .|.|:......|...||..:.:.|.:.|:......|.:...|.      |||.......::
  Fly     4 MD--NFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDD------AYSSGFNSDQEN 60

Zfish    66 IQKTDVQPPKRTGRPK----SKFPGVKRQTASEREKLRMRDLTKALHHLRTFLPASVAPVGKTLT 126
            .:||.....:|:.:|:    :.....:||.|:.||:.||:.:.:|...|||.:|  ..|..|.|:
  Fly    61 TEKTFCPFSRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIP--TLPYEKRLS 123

Zfish   127 KIETLRLAIQYISCLSDQL 145
            |::||:|||.||:.||:.:
  Fly   124 KVDTLKLAISYITFLSEMV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mespaaNP_571626.1 HLH 88..141 CDD:278439 23/52 (44%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.