DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPRR and Ptp61F

DIOPT Version :9

Sequence 1:NP_002840.2 Gene:PTPRR / 5801 HGNCID:9680 Length:657 Species:Homo sapiens
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:287 Identity:89/287 - (31%)
Similarity:146/287 - (50%) Gaps:21/287 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   373 SASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEI---DIPRHGTK--NRYKTILPNPLSRV 432
            :|:|:...::.:|.....|....|..|........|:.   :..||..:  |||:.:.|...||:
  Fly    13 AAARLQIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRI 77

Human   433 CLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEK 497
            .|:..:|     .|||||.:: ....|:.:|.||||:::||..||.|||::.|..::|:.||.||
  Fly    78 VLKRGSV-----DYINANLVQ-LERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEK 136

Human   498 NE-KCVLYWPEKRGI-------YGKVEVLVISVNECDNYTIR--NLVLKQGSHTQHVKHYWYTSW 552
            .: ||.||||.:.|.       :.|:.|.::.:....|:..|  .|...:...::.|..:.||:|
  Fly   137 KQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTW 201

Human   553 PDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDAL 617
            ||...|.|....|:.:..|.:....|:..||.||||||||||:|.|.........:.:.|..:..
  Fly   202 PDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVS 266

Human   618 SIVCQLRMDRGGMVQTSEQYEFVHHAL 644
            .::|:||..|.|::||::|.:|.:.|:
  Fly   267 KVLCELRSYRMGLIQTADQLDFSYQAI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPRRNP_002840.2 PTPc 392..644 CDD:214550 84/266 (32%)
PTPc 417..644 CDD:238006 79/238 (33%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 85/266 (32%)
PTPc 62..295 CDD:238006 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.