DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTA1 and Act57B

DIOPT Version :9

Sequence 1:NP_001091.1 Gene:ACTA1 / 58 HGNCID:129 Length:377 Species:Homo sapiens
Sequence 2:NP_523800.1 Gene:Act57B / 37368 FlyBaseID:FBgn0000044 Length:376 Species:Drosophila melanogaster


Alignment Length:377 Identity:350/377 - (92%)
Similarity:363/377 - (96%) Gaps:1/377 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 65
            ||| ||..|||.|||||:.||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MCD-DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 64

Human    66 ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFN 130
            |||||||||||||||||||||||||||||||||||||||.|||||||||||||||||||||||||
  Fly    65 ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 129

Human   131 VPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKIL 195
            .||||||||||||||||||||||||||||||:|.|||||||||||||:|||||||||||||||||
  Fly   130 SPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 194

Human   196 TERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCP 260
            |||||||.|||||||||||||||||||||||.||||||:|:||||||||||||||||||||||||
  Fly   195 TERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCP 259

Human   261 ETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPS 325
            |:||||||:||||.|||||.||||||||:|||||||||.|||||||||||||||||||||:||||
  Fly   260 ESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITSLAPS 324

Human   326 TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377
            |:||||||||||||||||||||||||||||||||:|:||||:||.|||||||
  Fly   325 TIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTA1NP_001091.1 PTZ00281 4..377 CDD:173506 345/372 (93%)
Interaction with alpha-actinin. /evidence=ECO:0000250|UniProtKB:P68135 112..125 12/12 (100%)
Interaction with alpha-actinin. /evidence=ECO:0000250|UniProtKB:P68135 360..372 7/11 (64%)
Act57BNP_523800.1 PTZ00281 1..376 CDD:173506 348/375 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D283838at33208
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X104
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.