DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPRM and PTP1

DIOPT Version :9

Sequence 1:XP_011524010.1 Gene:PTPRM / 5797 HGNCID:9675 Length:1507 Species:Homo sapiens
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:93/292 - (31%)
Similarity:139/292 - (47%) Gaps:66/292 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   961 NRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNY----IDGYH-RPNHYIATQGPMQETIYDF 1020
            |..:|||.||:.|:.:||.|:|:.|   :||||.:|    :.|.. .|.:|||||||.::|...|
Yeast    52 NDARNRYVNIMPYERNRVHLKTLSG---NDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQF 113

Human  1021 WRMVWHE---NTASIIMVTNLVEVGRVKCCKYWP---------------------DDTEIYKDIK 1061
            |:|.:|.   :...|:|||.|||..|.||.:|||                     |.|:...|:|
Yeast   114 WQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLK 178

Human  1062 VTLIETELLAEYVIRTFAVEKGGAGGEANCSPSREVSQRGVHEIREIRQFHFTGWPDHGVPYHAT 1126
            :..:....:.:|...|          :...:|:..:    |..::.:..|:|..|.|...|....
Yeast   179 IEFVNVHKVKDYYTVT----------DIKLTPTDPL----VGPVKTVHHFYFDLWKDMNKPEEVV 229

Human  1127 GLLGFVRQVKSKSPPSAG-PLVVHCSAGAGRTGCFIVIDIML----------------DMAEREG 1174
            .::...  ..|.|..|.| |::||||||.||||.||.:|.::                |.|..|.
Yeast   230 PIMELC--AHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEY 292

Human  1175 VVD-IYNCVRELRSRRVNMVQTEEQYVFIHDA 1205
            ..| |...|.:|||:|:.||||::|::||:.|
Yeast   293 TRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPRMXP_011524010.1 MAM 22..182 CDD:214533
MAM 27..182 CDD:99706
IG_like 192..278 CDD:214653
ig 192..274 CDD:278476
FN3 282..361 CDD:214495
FN3 383..477 CDD:238020
FN3 499..581 CDD:238020
PTPc 937..1208 CDD:214550 93/292 (32%)
PTPc 964..1208 CDD:238006 92/289 (32%)
PTPc 1240..1502 CDD:214550
PTPc 1270..1502 CDD:238006
PTP1NP_010051.1 COG5599 1..335 CDD:227886 93/292 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I1294
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.