DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPRG and PTP-ER

DIOPT Version :9

Sequence 1:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:547 Identity:123/547 - (22%)
Similarity:186/547 - (34%) Gaps:236/547 - (43%)


- Green bases have known domain annotations that are detailed below.


Human   835 FQTAHFYVED----SSSPRVV--PNESIPIIPIPDDMEAIP-----VKQFVKHIGELYSNNQHGF 888
            :||....:|.    .|:.|.|  |.:.:|  |..:|.|.:.     |.:..:.|.||..|.|   
  Fly   829 YQTNRNIIEQPPVLGSNARDVETPTDMVP--PSSEDSELLASYQTVVSRMAQPIPELKENEQ--- 888

Human   889 SEDFEEVQRCTADMNITAEHSNHPE------NKHKNRYINILAYDHSRV-------KLRPLPGKD 940
            ...|.::.:...|:.:     ||.|      ::.||||..||..::|||       :|..|.|:.
  Fly   889 KRIFRDLHKEFWDLPL-----NHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEI 948

Human   941 SKHSD--------YINANYVDGYN-KAKAYIATQGPLKSTFEDFWRMIWEQNT------------ 984
            .:.|.        ||||||:.|.: .:|.|:||||||.:|..:||.||: |||            
  Fly   949 KRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIY-QNTQRYIRRCVDGGS 1012

Human   985 ----------------GIIVMITNLVEKGRRKCDQYWPTENSEEYG------------------- 1014
                            ..|||:||..|..|:||..|:|.|.:|.:.                   
  Fly  1013 SSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFD 1077

Human  1015 -------------------------------NIIVTLKSTKIHACYT------------VRR--F 1034
                                           ::.|||:...:.|...            |||  :
  Fly  1078 RYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGY 1142

Human  1035 SIRNTKVKKGQKGNPKGRQNERVVIQYH--YTQWPDMGVP-------EYALPVLTFVRRSS---- 1086
            |:|...:....:.......:.:.:..||  |..|||...|       :..|.||...:..|    
  Fly  1143 SVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDI 1207

Human  1087 ------------AARMPE---------TGPV-LVHCSAGVGRTGTYIVIDSMLQQIK-------- 1121
                        ||:..|         ..|: ::|||||:||||.:..|.:.::|::        
  Fly  1208 YDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLT 1272

Human  1122 --------DKST-------------------------------------------------VNVL 1129
                    ..||                                                 |:||
  Fly  1273 GMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVL 1337

Human  1130 GFLKHIRTQRNYLVQTEEQYIFIHDAL 1156
            |.:.::|.||..:||..|||..||.|:
  Fly  1338 GIVCNLRLQRGGMVQNSEQYELIHRAI 1364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPRGXP_016862450.1 None
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 100/448 (22%)
PTPc 917..1364 CDD:238006 100/447 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.