DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPRG and CAH1

DIOPT Version :9

Sequence 1:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:329 Identity:86/329 - (26%)
Similarity:129/329 - (39%) Gaps:81/329 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    59 YWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKT 123
            :|.|:...||.||........|..|||:||....|:.|.|.....|          .| |...:.
  Fly     4 HWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPL----------KW-KYVPEH 57

Human   124 VAILLKDDYF----VSGAG--LPGR------FKAEKVEFHWGHSNGSAGSEHSINGRRFPVEAED 176
            ...|:...|.    |:||.  |.|.      ||.|:...|||.:: |.||||:::|..:..|   
  Fly    58 TKSLVNPGYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTD-SKGSEHTVDGVSYSGE--- 118

Human   177 ARGGDIMLMLSQGMRFILLGLKKEQFEERKSWTTYQSMQIFFYNPDDFDSFQTAISENRIIGAMA 241
                                                 :.:..:|...:.||..|.:....:..:.
  Fly   119 -------------------------------------LHLVHWNTTKYKSFGEAAAAPDGLAVLG 146

Human   242 IFFQVSPRDNSALDPIIHGLKGVVHHEKETFL----DPFVLRDLLPASLGSYYRYTGSLTTPPCS 302
            :|.:.. ..::.||.:...|:.|:|......|    ||   ..||| .:.:|:.|.|||||||||
  Fly   147 VFLKAG-NHHAELDKVTSLLQFVLHKGDRVTLPQGCDP---GQLLP-DVHTYWTYEGSLTTPPCS 206

Human   303 EIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEY---LRNNFRPQQRLHDRVVSKSAVRD 364
            |.|.||||:.|:.:|..||.|..::...:.::.....|:   :.|||||...|     .|..:|:
  Fly   207 ESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPL-----GKRELRE 266

Human   365 SWNH 368
            ...|
  Fly   267 IGGH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPRGXP_016862450.1 None
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 84/319 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.