DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPRD and PTP1

DIOPT Version :10

Sequence 1:NP_001364887.1 Gene:PTPRD / 5789 HGNCID:9668 Length:1932 Species:Homo sapiens
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:103/298 - (34%)
Similarity:140/298 - (46%) Gaps:75/298 - (25%)


- Green bases have known domain annotations that are detailed below.


Human  1687 PCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFI----------DGYRQQKAYIATQGPL 1741
            |.|..:||.|||||||..||.|:.:   .|:||||||::          .||     |||||||.
Yeast    50 PRNDARNRYVNIMPYERNRVHLKTL---SGNDYINASYVKVNVPGQSIEPGY-----YIATQGPT 106

Human  1742 AETTEDFWRMLWEHN----STIVVMLTKLREMGREKCHQYWPA---------------------- 1780
            .:|.:.||:|.: ||    :.::||:|.|.|..||||:||||.                      
Yeast   107 RKTWDQFWQMCY-HNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDM 170

Human  1781 ---ERSARYQYFVVDPMAEYNMPQYILREFKV--TDARDGQSRTVRQFQFTDWPEQGVPKSGEGF 1840
               ....:.::..|..:.:|    |.:.:.|:  ||...|..:||..|.|..|.:...|:.....
Yeast   171 TQFPSDLKIEFVNVHKVKDY----YTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPI 231

Human  1841 IDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVL----------ERMRY------EGV 1889
            ::.....|...   .:..||.|||||||||||.||.|..::          ||.|:      |..
Yeast   232 MELCAHSHSLN---SRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYT 293

Human  1890 VDIF-QTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGS 1926
            .|:. |.|..||:||..||||:||:.|.|.|| :||.|
Yeast   294 RDLIEQIVLQLRSQRMKMVQTKDQFLFIYHAA-KYLNS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPRDNP_001364887.1 I-set 24..115 CDD:400151
Ig strand B 41..45 CDD:409390
Ig strand C 54..58 CDD:409390
Ig strand E 77..84 CDD:409390
Ig strand F 95..100 CDD:409390
Ig strand G 108..111 CDD:409390
IgI_2_RPTP_IIa_LAR_like 127..226 CDD:409400
Ig strand A 127..129 CDD:409400
Ig strand A' 134..138 CDD:409400
Ig strand B 141..150 CDD:409400
Ig strand C 155..161 CDD:409400
Ig strand C' 163..165 CDD:409400
Ig strand D 174..178 CDD:409400
Interaction with IL1RAPL1. /evidence=ECO:0000250 180..189
Mini-exon peptide A9, sufficient for interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:Q64487 181..189
Ig strand E 190..195 CDD:409400
Ig strand F 204..211 CDD:409400
Ig strand G 214..225 CDD:409400
Mini-exon peptide B, required for interaction with SLITRK2 and in the function in pre-synaptic differentiation, Acts as an adjustable linker to control relative positions and orientations of the PTPRD second and third immunoglobilin domains for their simultaneous interactions with the first immunoglobilin domain of IL1RAPL1 and IL1RAP, Modulates affinity for IL1RAPL1 and IL1RAP. /evidence=ECO:0000250|UniProtKB:Q64487 227..230
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401
Ig strand A 239..241 CDD:409401
Ig strand A' 245..249 CDD:409401
Ig strand B 252..260 CDD:409401
Ig strand C 265..271 CDD:409401
Ig strand C' 273..275 CDD:409401
Ig strand D 278..282 CDD:409401
Ig strand E 287..292 CDD:409401
Ig strand F 299..306 CDD:409401
FN3 304..>736 CDD:442628
Ig strand G 310..319 CDD:409401
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..623
fn3 713..812 CDD:394996
FN3 <789..1127 CDD:442628
FN3 922..1013 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1304..1324
R-PTPc-D-1 1354..1637 CDD:350472
R-PTP-D-2 1638..1929 CDD:350476 103/298 (35%)
PTP1NP_010051.1 PTP_fungal 79..323 CDD:350509 81/256 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.